KEGG   Naumovozyma dairenensis: NDAI_0D02620Help
Entry
NDAI_0D02620      CDS       T02234                                 

Gene name
NDAI0D02620
Definition
hypothetical protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ndi  Naumovozyma dairenensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:ndi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ndi01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ndi00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ndi00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ndi00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ndi00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:ndi00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(606774..609737)
Genome map
AA seq 987 aa AA seqDB search
MASQGTCYGVAFRSVVTTDDTLFQETIQFYHKLGFSTIKDFNKFKNSDNHLLSVGTSQDS
IKEVWLEAFKLSEIDGQGFRVPQQEAANKNQSQGALLKVRQVMSQTPLPNESLNVIYFTA
ALNQIISKFPSAKKITDYLYILTDPLGNELAFTSFASPMDSNPMTDASCFQDPASATTSA
GSETVNASTSAINLLKQSLAGQKKKKIAVMTSGGDSPGMNAAVRAVVRTGIHFGCDVFAV
YEGYEGLLRGGKYLRQMAWEDVRGWLSEGGTLIGTARSMEFKKREGRKRAAGNLIAEGID
ALVVCGGDGSLTGADLFRHEWPSLVEDLVKEGTFTEAQVAPYKNLKIVGLVGSIDNDMSG
TDSTIGAYSALERICEMVDYIDATAKSHSRAFVIEVMGRHCGWLALMAGIATGADYIFIP
ERAVPHGKWQEELKQVCQRHRAKGRRNNTIIVAEGALDDQLNPVTADNVKDALIELGLDT
KVTILGHVQRGGTAVAHDRWLATLQGVDAVKAILEMTPETPSPLIGILENKIIRMPLVES
VKLTQSVAAAIENKDFDKAISLRDTEFIELYENFLSTTVRDDGSEMLPVTERLNIGIVHV
GAPSAALNAATRAATLYCLSHGHKPLAIMNGFSGLIQTGEVKELEWIDVENWHNLGGSEI
GTNRSVAAEDLGTIAYYFQKIKLDGLIILGGFEGFRSLKQLRDGRSQHPIFNIPMTLIPS
TISNNVPGTEYSLGVDTCLNALVNYTDDIKQSASATRKRVFVVEVQGGHSGYIASFTGLI
TGAVSVYTPEDKIDLSSIREDLTLLQENFRHDKGENRNGKILIRNEEASSVYSTQLIADI
ISESSKGSFGVRTAIPGHAQQGGVPSSKDRVVSSRYAVKCIKFIEQWNKKNQTPGSNVDA
KILRFTFDSQGEKISTVEHEDDSAAVICVNGSHITFKPIAGLWENETNVELRKGEEIHWT
EFNKIGDILSGRLRLRDEVAALSAESN
NT seq 2964 nt NT seq  +upstreamnt  +downstreamnt
atggcatctcaaggaacctgttacggtgtggccttcagatctgtagtcactaccgatgac
actctatttcaagaaacaatccaattctatcataaactaggtttttccaccatcaaagac
ttcaacaaattcaagaactctgacaatcacttattatctgtcggtacttctcaggactcc
atcaaagaagtatggttagaagctttcaaactaagtgaaattgacggtcaaggtttccgt
gtcccacaacaagaagcagccaacaagaatcaaagtcaaggtgctctcttaaaagtccgt
caagtcatgtctcaaaccccattaccaaatgaatccttaaatgtcatatatttcaccgct
gcattaaaccaaatcatctctaaattcccatcagcaaagaaaattaccgattatctatat
atcttaactgatccattaggtaacgaacttgcattcacttcattcgcatccccaatggat
tccaatccaatgactgacgcttcttgtttccaagacccagcttccgcaaccacttccgct
ggatctgaaacagttaacgcatccacttcagctatcaatcttttgaaacaatccctagct
ggacaaaaaaagaagaagatcgcagtcatgacctctggtggtgattctccaggtatgaac
gcagctgtgagagcagtggttcgtactggtattcatttcggttgtgatgtatttgccgtg
tatgaagggtacgaaggtttattaagaggtggtaaatatttgagacagatggcatgggaa
gatgttagaggttggttatctgaaggtggtactttgattggtactgctcgttccatggaa
tttaagaaacgtgaaggtcgtaagagagcagctggtaatttgatcgctgaaggtatcgat
gctttagtcgtttgtggtggtgatggttctttgactggtgctgacttgttcagacatgaa
tggccatctttagtggaagatttagttaaagaaggtactttcactgaagctcaagtggct
ccttataagaatttgaagattgtcggtcttgttggatctattgataatgatatgtctggt
actgattctactattggtgcttattctgctttggaaaggatttgtgaaatggtcgactat
atcgatgctactgctaaatctcattctcgtgccttcgttattgaagtcatgggtagacat
tgtggttggttagctcttatggctggtattgccactggtgctgattacattttcattcca
gaaagagcagtccctcatggtaaatggcaagaagaattgaaacaagtttgtcaaagacat
agagctaagggtagaagaaacaacactattattgttgctgaaggtgcattggatgatcaa
ttgaatccagtgactgctgataacgttaaagatgctcttattgaattgggtttagatacc
aaagtcacaatcctaggtcacgttcaaagaggtggtactgctgttgctcatgacagatgg
ttagctactctgcaaggtgttgatgccgttaaggctatcttggaaatgactccagaaact
ccatcgccattgattggtatcttagaaaacaaaatcattagaatgccattagttgaatct
gttaaattgactcaatctgttgctgcagctattgaaaataaagatttcgataaggctatt
tccttaagagacactgaattcattgaactatatgaaaacttcttatctactacagtgaga
gatgatggttctgaaatgttaccagttacagaaagattaaatattggtattgttcacgtc
ggtgccccatctgctgctttgaatgccgcaactcgtgctgccactctatactgtttatct
catggacacaagccacttgctatcatgaatggtttcagtggattgattcaaactggtgaa
gttaaagaattagaatggattgatgttgaaaactggcacaacttgggtggttctgaaatt
ggtactaacagatcagttgctgctgaagatttaggtactattgcttactatttccagaaa
attaaattagatggtttaattattcttggtgggtttgaaggtttcagatctttgaaacaa
ttacgtgatggtagatctcaacatccaattttcaacattccaatgactttgattccatct
actatctctaataatgttccaggtactgaatactccttaggtgtcgatacttgtttgaat
gctttagttaattacactgatgatatcaagcaaagtgcttctgctacaagaaagagagtt
tttgttgttgaagttcaaggtggtcattctggttacattgcttcatttacaggtttaatt
actggtgcagtttctgtgtatactccagaagataagattgatctatcatctatcagagaa
gatttaaccttgttacaagaaaacttccgtcatgataagggtgaaaacagaaatggtaag
attttgatcagaaatgaagaagcttccagcgtatatagtacacaattgattgctgatatc
atttccgaatccagtaaaggtagctttggtgttagaactgccattccaggtcatgctcaa
caaggtggtgttccttcttctaaggatcgtgttgtttcttccagatatgctgttaaatgt
attaaattcattgaacaatggaataagaagaaccaaactccaggtagtaatgttgatgct
aagatcttaagattcacattcgattctcaaggtgaaaagatttcaactgttgaacatgaa
gatgattctgctgctgttatctgtgttaacggttctcatattactttcaagccaattgca
ggtttatgggaaaacgaaaccaatgttgaattaagaaagggtgaagagatccattggact
gaatttaacaagattggtgacattttgtctggtagattaagattaagagacgaagttgct
gctttatctgccgaatccaactaa

DBGET integrated database retrieval system