KEGG   Naumovozyma dairenensis: NDAI_0D03800Help
Entry
NDAI_0D03800      CDS       T02234                                 

Gene name
NDAI0D03800
Definition
hypothetical protein
Orthology
K01440  
nicotinamidase [EC:3.5.1.19]
Organism
ndi  Naumovozyma dairenensis
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    NDAI_0D03800 (NDAI0D03800)
Enzymes [BR:ndi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     NDAI_0D03800 (NDAI0D03800)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:902627..903268
Genome map
AA seq 213 aa AA seqDB search
MKALLIIDVQNDFLPPNGTLAVPHGDEIVHPILELIHDEKQDWHRVVMTRDWHPKNHISF
AKRHNQEPYSKITYKSPKPGDKTTQEGVLWPVHCIQNTRGSQLADPLLKETYKNHYKIVD
KGFLSDREYYSAFHDIWNFHKTELHEYLQKHHITEVYIVGLALDYCVKETAISAAKLGYK
TTILKDYTKPVNSDDESMMKLKEEFNSYNIKLD
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctttattgatcattgacgttcaaaatgatttcctaccacctaacggtacattg
gcagttcctcatggtgatgaaattgttcatccaattttagagttgatacatgatgaaaag
caagattggcatcgtgtagtaatgacaagagattggcatcctaaaaaccatatctcattc
gcaaagagacataatcaggaaccatacagcaagataacatacaaatctcctaagcctggt
gacaaaaccactcaagaaggtgtcttatggcctgttcattgtattcaaaatacaagggga
agtcaattggccgatcctttattgaaagaaacatataaaaatcattataagatagtggat
aagggatttttatctgatagagaatattattctgccttccatgacatttggaatttccat
aagactgagttgcatgaatatttacaaaaacatcatattactgaagtgtacatcgtggga
ttggcattagattattgtgttaaagaaaccgcaatttctgcagcaaaattgggctataaa
actacaattctaaaagattatacaaaaccagtaaattctgatgatgaatcaatgatgaag
ttgaaagaagaattcaattcttataacattaaattagattga

DBGET integrated database retrieval system