KEGG   Naumovozyma dairenensis: NDAI_0D03800Help
Entry
NDAI_0D03800      CDS       T02234                                 

Gene name
NDAI0D03800
Definition
hypothetical protein
Orthology
K01440  
nicotinamidase [EC:3.5.1.19]
Organism
ndi  Naumovozyma dairenensis
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:ndi00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:902627..903268
Genome map
AA seq 213 aa AA seqDB search
MKALLIIDVQNDFLPPNGTLAVPHGDEIVHPILELIHDEKQDWHRVVMTRDWHPKNHISF
AKRHNQEPYSKITYKSPKPGDKTTQEGVLWPVHCIQNTRGSQLADPLLKETYKNHYKIVD
KGFLSDREYYSAFHDIWNFHKTELHEYLQKHHITEVYIVGLALDYCVKETAISAAKLGYK
TTILKDYTKPVNSDDESMMKLKEEFNSYNIKLD
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctttattgatcattgacgttcaaaatgatttcctaccacctaacggtacattg
gcagttcctcatggtgatgaaattgttcatccaattttagagttgatacatgatgaaaag
caagattggcatcgtgtagtaatgacaagagattggcatcctaaaaaccatatctcattc
gcaaagagacataatcaggaaccatacagcaagataacatacaaatctcctaagcctggt
gacaaaaccactcaagaaggtgtcttatggcctgttcattgtattcaaaatacaagggga
agtcaattggccgatcctttattgaaagaaacatataaaaatcattataagatagtggat
aagggatttttatctgatagagaatattattctgccttccatgacatttggaatttccat
aagactgagttgcatgaatatttacaaaaacatcatattactgaagtgtacatcgtggga
ttggcattagattattgtgttaaagaaaccgcaatttctgcagcaaaattgggctataaa
actacaattctaaaagattatacaaaaccagtaaattctgatgatgaatcaatgatgaag
ttgaaagaagaattcaattcttataacattaaattagattga

DBGET integrated database retrieval system