KEGG   Naumovozyma dairenensis: NDAI_0D03830Help
Entry
NDAI_0D03830      CDS       T02234                                 

Gene name
NDAI0D03830
Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ndi  Naumovozyma dairenensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NDAI_0D03830 (NDAI0D03830)
Enzymes [BR:ndi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     NDAI_0D03830 (NDAI0D03830)
Exosome [BR:ndi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NDAI_0D03830 (NDAI0D03830)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:912331..913353
Genome map
AA seq 340 aa AA seqDB search
MHTAEFLDIDRTDISSVLAGGYNHPLLREWQNERQLTKNMLIFPLFISDNEDDCCAIESL
PNIKRFGVNKLKEYMKPLVAKGLRSVILFGVPLKEGSKDPVGTSADDPQGPVIQAIKLLR
REFPDLYIMCDVCLCEYTSHGHCGVLYDDGTINREKSVARIAAVAVNYAKAGAHCVAPSD
MIDGRIKEIKRGLINAGLAHKTFVLSYSAKFSGNLYGPFRDAACSAPSSGDRKCYQLPSG
GRGLARRALRRDLGEGADGIIVKPSTFYLDIMRDASEICNDLPICAYHVSGEYAMLHAAA
EKGIIDLKTMAFESHQGFLRAGARLIITYFAPQFLEWLDN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcataccgctgaattcttagatatcgatagaactgatatttcctctgtcttagctggt
ggatacaatcaccccctattaagagaatggcagaatgaacgtcaattaacaaaaaatatg
ttaatttttcctcttttcatttcggataatgaagatgactgctgtgctatcgaatctctt
ccaaatatcaagagatttggtgtcaacaaattaaaggaatatatgaaaccattggttgcg
aaaggtttaagatctgttatattatttggcgtcccactaaaagaaggaagtaaggatcct
gttggtaccagtgcagacgatcctcaaggaccagttattcaagccattaagttgttacgt
agagaattcccagatctatatatcatgtgtgatgtttgtctttgtgaatatacttcacat
ggccattgtggtgttctgtatgatgatggaactatcaacagagaaaaaagtgttgccaga
attgctgctgttgctgtcaattatgccaaagcgggagcgcactgtgtagctccaagtgac
atgatcgacggcagaattaaagagatcaagagaggattaatcaacgctggattggctcat
aagacctttgtcttatcctattctgccaaatttagcggtaatctatacggcccattccgt
gatgctgcttgttcagccccttcatctggtgatagaaagtgttaccaattgccttcaggt
ggtcgcggattagcacgtagagctttgaggagagatcttggtgaaggtgcagatgggatc
atagttaaaccttctactttctacttagatatcatgagagatgcaagtgaaatttgtaat
gacttaccaatatgtgcatatcatgtctctggtgagtatgcaatgttacatgccgctgct
gaaaagggcattatagatttgaaaaccatggcatttgagtctcatcaaggtttcttgagg
gcaggcgccagattgataattacatattttgcaccacaattcctggaatggttagataac
tag

DBGET integrated database retrieval system