KEGG   Naumovozyma dairenensis: NDAI_0D04050Help
Entry
NDAI_0D04050      CDS       T02234                                 

Gene name
NDAI0D04050
Definition
(RefSeq) hypothetical protein
  KO
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ndi  Naumovozyma dairenensis
Pathway
MAPK signaling pathway - yeast
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    NDAI_0D04050 (NDAI0D04050)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    NDAI_0D04050 (NDAI0D04050)
Enzymes [BR:ndi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     NDAI_0D04050 (NDAI0D04050)
Protein kinases [BR:ndi01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   NDAI_0D04050 (NDAI0D04050)
Chromosome [BR:ndi03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     NDAI_0D04050 (NDAI0D04050)
Exosome [BR:ndi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NDAI_0D04050 (NDAI0D04050)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:952438..953538
Genome map
AA seq 366 aa AA seqDB search
MSRTITFDIPSQYQLVDLIGEGAYGTVCSAIHKPSGVKVAIKKIQPFSKAMFVTRTLREI
KLLTYFHNHENIISILDKVKPISVNKLNAVYLVQELMETDLQKIIMNSNNNPLSDDHIQY
FTYQILRALKAIHSAQVIHRDLKPSNLLLNSNCDLKVCDFGLSRCLTSSSDSRETLVGFM
TEYVATRWYRAPEIMLTFQEYTTAMDIWSVGCILAEMVSGRPLFPGRDYHHQLWLILEVL
GTPSLEDFAQIKSKRAKEYISNLPMRSPMPWVNVLNTQRNLNPDMLDLLTKMLLFNPNKR
ITAAEALNHPYLATYHDPEDEPDYPPLNLNDEFWKLDNEIRQPDDEEISMDILKQMLYDE
VIKTMD
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtccagaacaattacattcgatataccatcacaataccaattagtagatttaatagga
gaaggtgcatatggtacagtttgttctgcaattcataaaccgtctggagttaaagttgcc
atcaaaaaaattcaaccatttagtaaagcaatgttcgtaacaagaacattaagagaaatc
aaattattaacatatttccataatcacgaaaatataattagcatattagataaagtgaaa
ccaatttctgtgaataaattaaatgcagtttacctcgtgcaagaattaatggaaacagat
ttacaaaaaattataatgaatagtaataataatccattgagtgatgatcacattcaatat
ttcacttatcaaatattaagagctttgaaagcaattcatagcgcacaagtaatacataga
gacttaaaaccatcaaaccttttattgaattcaaattgtgatttgaaagtttgtgatttc
ggtctttcaagatgtttaacaagtagtagtgattcaagagaaactttggttggtttcatg
acagaatatgtagctacaagatggtatagagctccagaaataatgttaactttccaagag
tatacaactgcaatggatatttggtccgttggttgcatccttgctgaaatggtttcagga
agaccacttttcccaggtagagattatcatcatcaattatggttaatattagaagtccta
ggtactccctcattagaagatttcgcccaaattaaatccaaaagagccaaagaatatatt
tcaaatttaccaatgagaagccccatgccatgggttaatgtcttgaatacacaacggaat
ttaaatccagatatgttagatcttctcacgaagatgctattgttcaatcctaataaaaga
atcactgcagcagaagctctcaatcatccatatttggccacttatcatgatccagaagat
gaacctgattatccaccattgaatttaaatgatgaattttggaaattagataatgaaatt
agacaacctgatgatgaagaaatatcaatggatattttaaagcaaatgctttatgatgaa
gtcattaaaactatggattga

DBGET integrated database retrieval system