KEGG   Naumovozyma dairenensis: NDAI_0D04050Help
Entry
NDAI_0D04050      CDS       T02234                                 

Gene name
NDAI0D04050
Definition
(RefSeq) hypothetical protein
Organism
ndi  Naumovozyma dairenensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:952438..953538
Genome map
AA seq 366 aa AA seqDB search
MSRTITFDIPSQYQLVDLIGEGAYGTVCSAIHKPSGVKVAIKKIQPFSKAMFVTRTLREI
KLLTYFHNHENIISILDKVKPISVNKLNAVYLVQELMETDLQKIIMNSNNNPLSDDHIQY
FTYQILRALKAIHSAQVIHRDLKPSNLLLNSNCDLKVCDFGLSRCLTSSSDSRETLVGFM
TEYVATRWYRAPEIMLTFQEYTTAMDIWSVGCILAEMVSGRPLFPGRDYHHQLWLILEVL
GTPSLEDFAQIKSKRAKEYISNLPMRSPMPWVNVLNTQRNLNPDMLDLLTKMLLFNPNKR
ITAAEALNHPYLATYHDPEDEPDYPPLNLNDEFWKLDNEIRQPDDEEISMDILKQMLYDE
VIKTMD
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtccagaacaattacattcgatataccatcacaataccaattagtagatttaatagga
gaaggtgcatatggtacagtttgttctgcaattcataaaccgtctggagttaaagttgcc
atcaaaaaaattcaaccatttagtaaagcaatgttcgtaacaagaacattaagagaaatc
aaattattaacatatttccataatcacgaaaatataattagcatattagataaagtgaaa
ccaatttctgtgaataaattaaatgcagtttacctcgtgcaagaattaatggaaacagat
ttacaaaaaattataatgaatagtaataataatccattgagtgatgatcacattcaatat
ttcacttatcaaatattaagagctttgaaagcaattcatagcgcacaagtaatacataga
gacttaaaaccatcaaaccttttattgaattcaaattgtgatttgaaagtttgtgatttc
ggtctttcaagatgtttaacaagtagtagtgattcaagagaaactttggttggtttcatg
acagaatatgtagctacaagatggtatagagctccagaaataatgttaactttccaagag
tatacaactgcaatggatatttggtccgttggttgcatccttgctgaaatggtttcagga
agaccacttttcccaggtagagattatcatcatcaattatggttaatattagaagtccta
ggtactccctcattagaagatttcgcccaaattaaatccaaaagagccaaagaatatatt
tcaaatttaccaatgagaagccccatgccatgggttaatgtcttgaatacacaacggaat
ttaaatccagatatgttagatcttctcacgaagatgctattgttcaatcctaataaaaga
atcactgcagcagaagctctcaatcatccatatttggccacttatcatgatccagaagat
gaacctgattatccaccattgaatttaaatgatgaattttggaaattagataatgaaatt
agacaacctgatgatgaagaaatatcaatggatattttaaagcaaatgctttatgatgaa
gtcattaaaactatggattga

DBGET integrated database retrieval system