KEGG   Naumovozyma dairenensis: NDAI_0D04630Help
Entry
NDAI_0D04630      CDS       T02234                                 

Gene name
NDAI0D04630
Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ndi  Naumovozyma dairenensis
Brite
Enzymes [BR:ndi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     NDAI_0D04630 (NDAI0D04630)
Transcription machinery [BR:ndi03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     NDAI_0D04630 (NDAI0D04630)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:1090486..1091964
Genome map
AA seq 492 aa AA seqDB search
MVTRRRSRTVEESVDNSKESTLESNVNEEDQDESKEDEEDGPLPKKIKLDNANGDTKDIV
NDDDGDGAELSDKPSKEELITPTPVIVNLDDADAKDDDTDAKVNGDTNIDSKNPVIDETI
ADEEKGIVSFEFDGVEYKFKERASVIEEKEGKIEFRVVNNDNTKENMMVLTGLKNIFQKQ
LPKMPKEYIARLVYDRSHLSMAVVRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRG
YGAHLMNHLKDYVRNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGG
TLMQCSMLPKIRYLDAGKILLLQEAALRRKIRTISKSHVVRPGLEVFKELKNIKPIDPMT
IPGLKEAGWTPEMDELAQRPKRGPHFAAIQNILTELQNHAAAWPFLQPVNKEEVPDYYEF
IKEPMDLSTMEIKLENNKYQKMEDFIYDARLVFNNCRMYNGENTSYFKYANRLEKFFNSK
IKEIPEYAGLLN
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggtgacaagacgtagaagtcgtactgttgaagaatctgtggataatagcaaagaatcc
actttggaatccaatgttaatgaagaagaccaagacgaaagtaaagaagatgaagaggat
ggaccattaccgaaaaaaatcaaattagataatgctaacggcgataccaaggacatagtc
aatgatgatgatggtgatggtgctgaattatcagataagccttctaaagaggagctaatt
acgccaacacctgtgattgtaaatctcgatgatgcggatgcaaaagatgatgatacggac
gcaaaagtaaatggcgatacgaatatagattccaaaaatccggtaatagatgaaacaatt
gctgatgaggagaaaggaatagtaagttttgaattcgatggtgtagaatataaattcaaa
gaaagagctagtgttattgaagaaaaggaagggaagattgaatttagagtagtaaacaat
gataatacaaaggaaaatatgatggttttaacaggattgaaaaatattttccaaaagcaa
ttacctaagatgcccaaagaatatattgcaagattggtttatgatcgaagtcatctttca
atggctgtagtgaggaaaccattgactgtagttggtggtatcacatatagaccatttgat
aaaagagaatttgcagaaatcgtattttgtgctattagctctactgaacaagttcgtggg
tatggtgcccatttgatgaatcatttgaaagattatgttagaaatacctcaaatattaaa
tatttcttaacttatgctgataattatgccataggttattttaagaaacaaggtttcaca
aaggaaattactttggataaaagcatttggatggggtatattaaagattatgaaggtggt
acattaatgcaatgttcaatgttacctaaaatacgatatttagatgcaggtaaaattctt
ttgttacaagaagcagcacttcgaaggaaaattagaacgatatctaaatctcatgtagta
aggccaggattagaagtatttaaagagctcaaaaatattaaacctatcgatccaatgaca
atccctggtttaaaagaagcaggttggactcctgaaatggatgaattagctcaaagaccg
aaaagaggaccacattttgccgctatccaaaacatattgacagaacttcaaaatcatgct
gcagcttggccattcttacaaccagttaataaagaagaagtcccagactattatgaattc
attaaagaaccaatggatttaagtaccatggaaattaaattagaaaataataaatatcaa
aaaatggaagactttatttatgatgcaagattggtattcaacaactgtagaatgtacaat
ggtgaaaatacttcatatttcaaatatgctaatagattagagaagttcttcaattcaaag
attaaggaaataccagaatatgcaggtttattaaactga

DBGET integrated database retrieval system