KEGG   Naumovozyma dairenensis: NDAI_0D04640Help
Entry
NDAI_0D04640      CDS       T02234                                 

Gene name
NDAI0D04640
Definition
(RefSeq) hypothetical protein
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
ndi  Naumovozyma dairenensis
Brite
Protein phosphatases and associated proteins [BR:ndi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     NDAI_0D04640 (NDAI0D04640)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_4 SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 11495180
NCBI-ProteinID: XP_003670020
UniProt: G0WAG6
Position
4:complement(1092523..1093050)
Genome map
AA seq 175 aa AA seqDB search
MGAAPSKIVDNLLEDTNFDLDEIERLRKRFMKLDRDSSGSIDKNEFMSIPGVSSNPLAGR
IMEVFDADNSGDVDFQEFITGLSIFSGRGSKNEKLKFAFKIYDIDKDGFISNGELFIVLK
IMVGSNLNDEQLQQIVDRTIMENDLDGDGHLSFEEFKSAIETTEVAKSLTLDIDI
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcagctccttctaaaattgtagataatcttctggaagatacaaattttgattta
gatgaaattgaaagattaaggaaaagattcatgaaacttgatcgagatagttcaggatct
atcgataagaatgaatttatgagtattcccggtgtttcctccaatccattagctggtcgt
ataatggaagtttttgatgctgataatagtggtgatgtcgacttccaagaatttattacc
ggtctctccatatttagtgggagaggcagtaagaatgaaaaattgaaatttgctttcaag
atttatgatattgataaagatgggttcatatcaaatggtgaattatttatcgttttgaaa
attatggtgggttctaatttaaacgatgaacaattacaacagattgtagatagaactata
atggaaaatgaccttgatggtgatggacatttaagttttgaagaatttaaaagtgctatc
gaaacaacagaagttgcaaagagtttgacattagatatagatatataa

DBGET integrated database retrieval system