KEGG   Naumovozyma dairenensis: NDAI_0D04640Help
Entry
NDAI_0D04640      CDS       T02234                                 

Gene name
NDAI0D04640
Definition
hypothetical protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
ndi  Naumovozyma dairenensis
Brite
Protein phosphatases and associated proteins [BR:ndi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     NDAI_0D04640 (NDAI0D04640)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(1092523..1093050)
Genome map
AA seq 175 aa AA seqDB search
MGAAPSKIVDNLLEDTNFDLDEIERLRKRFMKLDRDSSGSIDKNEFMSIPGVSSNPLAGR
IMEVFDADNSGDVDFQEFITGLSIFSGRGSKNEKLKFAFKIYDIDKDGFISNGELFIVLK
IMVGSNLNDEQLQQIVDRTIMENDLDGDGHLSFEEFKSAIETTEVAKSLTLDIDI
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcagctccttctaaaattgtagataatcttctggaagatacaaattttgattta
gatgaaattgaaagattaaggaaaagattcatgaaacttgatcgagatagttcaggatct
atcgataagaatgaatttatgagtattcccggtgtttcctccaatccattagctggtcgt
ataatggaagtttttgatgctgataatagtggtgatgtcgacttccaagaatttattacc
ggtctctccatatttagtgggagaggcagtaagaatgaaaaattgaaatttgctttcaag
atttatgatattgataaagatgggttcatatcaaatggtgaattatttatcgttttgaaa
attatggtgggttctaatttaaacgatgaacaattacaacagattgtagatagaactata
atggaaaatgaccttgatggtgatggacatttaagttttgaagaatttaaaagtgctatc
gaaacaacagaagttgcaaagagtttgacattagatatagatatataa

DBGET integrated database retrieval system