KEGG   Naumovozyma dairenensis: NDAI_0D04780Help
Entry
NDAI_0D04780      CDS       T02234                                 

Gene name
NDAI0D04780
Definition
hypothetical protein
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
ndi  Naumovozyma dairenensis
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NDAI_0D04780 (NDAI0D04780)
Enzymes [BR:ndi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     NDAI_0D04780 (NDAI0D04780)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:1119585..1124414
Genome map
AA seq 1609 aa AA seqDB search
MNITQDKSTPSSSSSASPISTSQERKGLPEQLIQAKHDWFLSSIGNFTWVIIYFCTGSTM
FVLKGISYILTLFLLQIPGKIIHSANKMRFTISFTVILTVIAILIYITYCIVKARVLSQY
KKLTPDEDSLLMNQNIGAGTNREAGSTPLNRSENMKNRNSNNINDDTFLSSYLDQFLSAI
KIFGYLEKPVFHALTKNMKTQKLDEGEILLLDNSIGFAIVVEGTLQVFHEVEQTADEIVR
NEARDDITEHESVLRVEALTNNDNEDLTTYNSGISDSDSDSDFDSDDESSGYIRLKNGLG
KFQLLNTVKPGNPISSLVNILNLFTSANPNASPYNINGSRSDSNDRGNSNNIDMQLQFGK
FTLNSDNATSSCPTPSMDTTPPLQSSEHIPALLSPYSIPKVVARASTDCTIAIIPPQAFA
RLTAKYPRSASHMIQMILAKLYNVTFQTAHNYLGLTREIMDIELSLNRSVKYELPYYLKE
TVIRKSKASNSEIKHNDSNRHARKSSFESSKPRLDSKTTSLSNDNLQAPIPAKPSRNSMV
IGSRHVVLDSRDHLNPGDLLSNVPLSRKEYNDDTPARDSKSPNQWTSKANASHDHIDTKK
HLKSYDRPKLKKNYQNGSSASFIKTLKTKHGMNEDIKTRSFSAAQEETEDSSVRMAVTEA
FFAFMGVSQSNMSAANPETSFTDSNTNLGRSVHRSSEISLDPSIGSSVTHQTTLRILPSE
YTITSRRQMKRNKKKKPYKEEISSNLDFDSAKNEFAQGLQLKFFKQGSNIVEANSDGKGM
FYVISGKISVSTSSDSDDHPTNKKNHKIEHTLFSIGSGGIAGYLSGIVGYKSFVNLKAQT
DVYVGFLPNKVIERLCDKYFLIYLRIAETLSGLLSSRMLKLDHALEWVHLSASETLFSQD
DPANGIYVVLNGRLRQLQERKRNTTNDVNEAITHHDSKKDKMKNSTTYPVVVGELAQGES
FGEVEVLTAMNRFTTIVAVRDSELARIPRTLFESIAMEHPSIMIRVSRLVAKKIMGNNYT
QNNEDNNLAIPLTKSLNSLNSHYQTQNHSSGKITFRTITILPIREGLPVENFAMKLVQAF
KQVGRNTIGLNQRTTLTHLGRHAFDRLAKLKQSGYFAELEEMYQTVVYIADTPSKSSWTQ
TCIAQGDCILLLADATSLPDIGEYENLLLKSKTTARTELILLHPERYVEPGLTQKWLRYR
PWVHSHHHIQLVVNPLEGISANKIHGFNGGALALVDKFIQTDFSKKTQQNISKLLPDSLK
TTVENFSSRFMKKRNAQFYTPTNPHKNDFLRLARILSGQAIGLVLGGGGARGLSHLGVIQ
AIEEQGIPIDMIGGTSIGSFVGGLYAKDYDLVPIYGRVKKFAGRISSLWRTLLDLTWPVT
SYTTGHEFNRGIWKTFGDTRIEDFWIQYYCNSTNITNSVQEIHSFGYAWRYIRASMSLAG
LLPPLEEHGSMLLDGGYLDNLPVLEMKARGCDTIFAVDVGSVDDRTPMKYGDSLNGFWIV
FNRWNPFSSHPNVPNMAEIQVRLGYVASVNALEKAKNTAGVLYIRPPIENYATLDFGKFE
EIYAVGVDYGRIFFQELESEGKMPFLPGCQAQVVASEVPEFLLHRRHSI
NT seq 4830 nt NT seq  +upstreamnt  +downstreamnt
atgaacataacgcaagacaaatcaactccatcctcatcttcatcagcttctccaatatcg
acatcacaagaaagaaaaggcttacctgagcaattaattcaagcaaagcatgactggttt
ttatccagtattgggaatttcacatgggtaatcatatatttctgtacaggctcaacgatg
tttgtcttaaagggtatatcatacattttaactcttttccttttacaaattccaggtaaa
atcattcattcagcaaataagatgcggtttactatttcattcactgttatcttaacagtc
atagcaatcttaatctatatcacatactgtattgtaaaggcaagggtattatcacagtat
aaaaaattaacacctgacgaagatagtctccttatgaatcaaaacattggtgcaggtacg
aatagagaagcaggttcgacacctcttaatcgatcggaaaatatgaaaaatcgtaattca
aataatatcaatgatgatactttcttatcatcttacttggaccaatttttaagcgctata
aaaatttttgggtatttggaaaaacctgttttccatgcattaactaagaatatgaaaact
caaaaactagatgaaggtgaaatcttattattagataattctatcggatttgcaatagtt
gtagaggggactttgcaagttttccatgaagtagaacaaactgctgatgaaatagttaga
aatgaagctagagatgacattacggaacatgaatcagttttacgagtagaagcactcact
aataatgataatgaggatcttactacttataatagtggcatctcagattcagactcggat
tcagactttgattcggacgatgaatcgtcaggttacattcggttgaaaaacggattaggt
aaatttcaattattaaatacagttaaaccaggtaatccaatatcttccttagtaaatatt
ctgaacttgtttacatctgcaaaccctaatgcatcgccttataatataaatggctcaagg
tccgatagtaatgatagagggaactcaaacaacattgacatgcaattacaatttggtaaa
ttcactttaaatagtgacaacgcgacttctagctgtccaacaccatctatggatacaacg
cctccccttcaatcttctgaacatattccagctctattatcaccatattctatcccaaag
gtcgttgcccgtgctagtacagactgtaccattgcaataattccacctcaggcgtttgct
agattgactgctaaatatcctagatctgcttcacatatgattcaaatgattttagccaaa
ttatacaacgtgacctttcaaacagcacataattatttgggtttgactcgtgaaattatg
gatattgaactatccttgaatcgttcagtcaaatatgaacttccttattatttaaaagaa
accgtcattagaaaatccaaggcttctaattcggaaattaaacataatgatagtaatcgc
catgcaagaaaatcaagttttgaatccagtaaaccaagattagattctaagactacatcg
ttatccaacgataaccttcaagcacccatcccagcaaaaccgagccggaactctatggta
atcggttcgagacatgttgttctagattcaagagatcacttaaacccaggtgacttgtta
tcaaatgtaccactatctagaaaagaatacaatgatgacactccagcaagagattcaaag
tcgccaaatcaatggacgtcaaaggcaaacgcctcacacgatcatatagatacgaaaaaa
catttaaaatcatacgaccgtcctaagctcaaaaaaaattatcaaaatggatcttccgca
agtttcattaagacattgaaaacaaagcatggaatgaatgaggacataaagacaagatca
ttttcagcagctcaggaggaaacagaagactcttctgttcggatggctgttactgaagca
ttttttgcttttatgggagttagccaatctaatatgtcagccgcgaacccagagacttcc
ttcactgacagtaacactaacctaggcaggagtgtccaccgctcatccgaaatttcattg
gatccttccataggatcctctgtgacacatcaaacaacactacgaatcttgccaagtgaa
tacactatcacttcaagaagacaaatgaaacgtaacaagaaaaagaaaccatataaagaa
gaaatttcatctaatttagatttcgactctgctaaaaatgaatttgctcaaggacttcaa
ttgaagtttttcaaacaaggatccaatattgttgaagcaaactccgatgggaaaggtatg
ttttacgttatttctggtaaaatatcagtctcaacatccagcgatagcgatgatcatcca
accaataagaaaaatcataaaatagaacatacactcttctcgataggaagtggtggtatc
gctggttatctttctgggattgtaggttataaatcctttgttaatttaaaagcacaaaca
gatgtatacgttgggtttttaccaaataaagtaattgaacgattatgcgacaaatacttc
ttgatatatctacgtatcgctgagactttgagcggtttactctcttcaagaatgttgaaa
ctagatcatgctttagaatgggttcatctttctgcatcagagacattattttcgcaagac
gatcccgcaaatggtatatatgtagttttgaacggtagattaagacaattgcaagaaagg
aagagaaatacaacaaatgatgtgaatgaagcaattactcatcatgacagcaagaaagat
aagatgaagaattctacaacatatccagtggttgtgggagaattagcacaaggcgaaagt
tttggagaagttgaagtgttgacagctatgaacagattcacaacaattgtagctgtaaga
gattcagagttagcccgtattccaagaacactatttgaatccatcgcgatggaacatcca
tcaattatgattcgtgtttcacgattggtcgcgaaaaaaattatggggaataactatact
caaaataatgaagataataatcttgctatcccattaacgaaatcattgaactctttgaat
tcccattatcaaacccagaatcattcttctggtaaaataactttcagaactattacaata
ttgccaattagagaaggactaccagtagaaaatttcgcaatgaagttagtacaagctttc
aagcaagtaggacgtaatacaatagggttaaatcagcgtacgacacttacccatttggga
cgccatgcgtttgatagattagccaaattgaaacaaagtggttattttgccgagttggaa
gagatgtatcaaacggtcgtttacattgccgatacaccgagtaaatcgagctggacgcaa
acgtgtattgctcaaggtgattgtattctcttattagcagatgctacatcattaccagat
attggtgaatatgagaatctattattgaaatcaaagacaacggcaagaacagaattgatt
ttgttgcaccctgaaagatacgtagaacctggcttgacacaaaaatggctacgatacaga
ccatgggttcattcacatcatcacattcaattagtcgttaatcctttggagggtatctct
gcaaataagatccatggttttaacggaggtgccttggcattagtagataaatttattcag
actgatttcagcaaaaaaacacaacaaaatatttccaaattattgcctgattcacttaaa
actactgtcgaaaatttttcttctagattcatgaagaaaaggaatgcccaattttataca
cccacaaatccgcacaaaaatgattttttaagacttgctagaattctttcaggacaagct
atcggtttggtacttggtggtggtggtgcgagaggtttgagccatttaggagtcatacaa
gctatagaggaacaaggtattcctattgacatgataggtggtacctccatcggttcattc
gtcggaggtttatatgccaaggattatgatttggtccccatctatgggcgggttaagaag
tttgcaggtagaatttcttccctatggagaacattattggacttaacatggccagtaaca
tcatacacaactgggcatgaatttaatcgtggtatatggaagacatttggtgacacgaga
attgaagatttctggatccagtattattgcaactcgacgaatatcaccaattcagtacaa
gaaatacattcttttggttatgcgtggcgttatattagagcatctatgtctcttgcaggt
ttacttccgcctttggaagagcatggatctatgctattggacggtggttatctggataat
ttacctgttttagaaatgaaagcccgtggctgcgatactatttttgctgttgatgttggt
tcagtagacgatagaaccccaatgaaatatggtgattctttaaatgggttttggattgta
ttcaatagatggaacccattttcttctcaccctaacgttccgaatatggcagagatccaa
gtccgtctaggttatgtagcgtctgttaacgcattagagaaggcaaaaaatacggctgga
gtactatatattagaccacctattgaaaattatgcaacattggattttggtaaatttgag
gagatatatgctgttggtgttgattacggtaggatctttttccaagagttagaaagtgaa
ggtaaaatgccatttctaccaggttgtcaagcacaggttgttgcttcagaagtgccagaa
tttttattacatagaagacacagtatttaa

DBGET integrated database retrieval system