KEGG   Naumovozyma dairenensis: NDAI_0E00810Help
Entry
NDAI_0E00810      CDS       T02234                                 

Gene name
NDAI0E00810
Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
ndi  Naumovozyma dairenensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:complement(163826..165307)
Genome map
AA seq 493 aa AA seqDB search
MGHCRHIDQVFKNEKSREGVLKSCNAARFILKHSIMKQKYLYAMRCSTCKEINAGSTFMC
LQCDFSGCWNNSDFANHSKQMGHIFSINSSNGLLFCFKCVDYIGDVEQINYSMLNKFWDD
ISKKTHITSQERKDGLFGLVNMGSTCFMSSILQTLIHNPYVVNYSMCQTHYNMCQSKNPL
SCTSCALDLIITEFYATESKGNNSSHTGFISLLNSLLQVNENFAGYSQQDAHEFLQFILN
QIHNDYKLNSMEDVNSGNTTAIAMKTLPGTQNSNNNNNNTNHIHGNDVSCKCLSHSNFQG
SLKSSILCPQCNNDSKTTIDPFMDLSLDVKDKSNLYQCLDSFHKLEKLHDFNFHCSECNS
TQDPIKQLTLNKLSPLLVFQLKRFEHLLNGTTVKINDFIEYPLYLNMKTYCQSSNNDTEE
EESNSENVPDMIYELTSIISHKGTVNEGHYIVVVKVNDGQWFKFNDSMVSAITEEEALKQ
QAYLLFYSVFQLN
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgggacattgcagacacatcgatcaagtattcaaaaatgaaaaatcaagagaaggggtt
cttaaatcatgtaatgcagctagatttattttaaagcattcaataatgaaacaaaaatat
ttatatgcaatgaggtgttctacatgtaaagagatcaatgcaggttctacatttatgtgc
ttacaatgtgatttctctggatgttggaataattctgattttgcaaaccatagtaagcaa
atgggtcacattttttcaataaattcaagtaatggactcttgttttgttttaaatgtgtt
gattatatcggtgatgtcgaacaaattaattactccatgttgaataaattttgggatgat
atttctaaaaagactcacattacttcacaggaacggaaagatggtcttttcggattagtt
aatatgggatccacatgctttatgagtagtattttacaaactttgattcataatccttac
gtcgttaattactctatgtgtcaaactcattataatatgtgtcaatcgaaaaatccctta
tcatgtacctcttgcgcattagatttaatcattacagaattctatgccactgaatcgaag
ggtaataatagttcacatactgggtttatttcattattaaattcattgctacaagttaat
gagaattttgctgggtactcgcaacaggatgctcatgaatttttacaatttattttaaat
caaatacataatgattacaaacttaactcaatggaagatgtaaatagcggtaatactact
gctattgccatgaagactcttcctgggactcaaaatagtaataataataataataatact
aatcatattcacggtaatgacgtatcatgtaaatgtctaagtcattcaaatttccaaggt
tcattgaaaagttccatcctatgtccacaatgtaataatgattcaaagacaacaattgac
ccctttatggatctttccttagatgttaaagataaatctaatttatatcaatgtcttgat
agtttccataaattagaaaaattacatgatttcaattttcattgttctgaatgcaatagt
acacaggatccaattaaacaattaacattgaataaattatcccctttattagttttccaa
ttgaaaagatttgaacatttacttaatggtacgacagtgaaaataaacgattttattgaa
tatccgttgtatttgaatatgaaaacttattgtcaaagctctaataatgatacagaagaa
gaggaaagtaatagcgagaatgttcctgatatgatctatgaattaactagtataatatct
cataagggcactgttaatgaagggcattatatcgttgtggtaaaggttaatgatgggcag
tggtttaaatttaatgattcgatggtttctgccattactgaagaagaggcattaaaacaa
caggcatatttattattttattcagttttccaactaaattaa

DBGET integrated database retrieval system