KEGG   Naumovozyma dairenensis: NDAI_0E00810Help
Entry
NDAI_0E00810      CDS       T02234                                 

Gene name
NDAI0E00810
Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
ndi  Naumovozyma dairenensis
Brite
Enzymes [BR:ndi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     NDAI_0E00810 (NDAI0E00810)
Peptidases [BR:ndi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NDAI_0E00810 (NDAI0E00810)
Transcription machinery [BR:ndi03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     NDAI_0E00810 (NDAI0E00810)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:complement(163826..165307)
Genome map
AA seq 493 aa AA seqDB search
MGHCRHIDQVFKNEKSREGVLKSCNAARFILKHSIMKQKYLYAMRCSTCKEINAGSTFMC
LQCDFSGCWNNSDFANHSKQMGHIFSINSSNGLLFCFKCVDYIGDVEQINYSMLNKFWDD
ISKKTHITSQERKDGLFGLVNMGSTCFMSSILQTLIHNPYVVNYSMCQTHYNMCQSKNPL
SCTSCALDLIITEFYATESKGNNSSHTGFISLLNSLLQVNENFAGYSQQDAHEFLQFILN
QIHNDYKLNSMEDVNSGNTTAIAMKTLPGTQNSNNNNNNTNHIHGNDVSCKCLSHSNFQG
SLKSSILCPQCNNDSKTTIDPFMDLSLDVKDKSNLYQCLDSFHKLEKLHDFNFHCSECNS
TQDPIKQLTLNKLSPLLVFQLKRFEHLLNGTTVKINDFIEYPLYLNMKTYCQSSNNDTEE
EESNSENVPDMIYELTSIISHKGTVNEGHYIVVVKVNDGQWFKFNDSMVSAITEEEALKQ
QAYLLFYSVFQLN
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgggacattgcagacacatcgatcaagtattcaaaaatgaaaaatcaagagaaggggtt
cttaaatcatgtaatgcagctagatttattttaaagcattcaataatgaaacaaaaatat
ttatatgcaatgaggtgttctacatgtaaagagatcaatgcaggttctacatttatgtgc
ttacaatgtgatttctctggatgttggaataattctgattttgcaaaccatagtaagcaa
atgggtcacattttttcaataaattcaagtaatggactcttgttttgttttaaatgtgtt
gattatatcggtgatgtcgaacaaattaattactccatgttgaataaattttgggatgat
atttctaaaaagactcacattacttcacaggaacggaaagatggtcttttcggattagtt
aatatgggatccacatgctttatgagtagtattttacaaactttgattcataatccttac
gtcgttaattactctatgtgtcaaactcattataatatgtgtcaatcgaaaaatccctta
tcatgtacctcttgcgcattagatttaatcattacagaattctatgccactgaatcgaag
ggtaataatagttcacatactgggtttatttcattattaaattcattgctacaagttaat
gagaattttgctgggtactcgcaacaggatgctcatgaatttttacaatttattttaaat
caaatacataatgattacaaacttaactcaatggaagatgtaaatagcggtaatactact
gctattgccatgaagactcttcctgggactcaaaatagtaataataataataataatact
aatcatattcacggtaatgacgtatcatgtaaatgtctaagtcattcaaatttccaaggt
tcattgaaaagttccatcctatgtccacaatgtaataatgattcaaagacaacaattgac
ccctttatggatctttccttagatgttaaagataaatctaatttatatcaatgtcttgat
agtttccataaattagaaaaattacatgatttcaattttcattgttctgaatgcaatagt
acacaggatccaattaaacaattaacattgaataaattatcccctttattagttttccaa
ttgaaaagatttgaacatttacttaatggtacgacagtgaaaataaacgattttattgaa
tatccgttgtatttgaatatgaaaacttattgtcaaagctctaataatgatacagaagaa
gaggaaagtaatagcgagaatgttcctgatatgatctatgaattaactagtataatatct
cataagggcactgttaatgaagggcattatatcgttgtggtaaaggttaatgatgggcag
tggtttaaatttaatgattcgatggtttctgccattactgaagaagaggcattaaaacaa
caggcatatttattattttattcagttttccaactaaattaa

DBGET integrated database retrieval system