KEGG   Naumovozyma dairenensis: NDAI_0E00840Help
Entry
NDAI_0E00840      CDS       T02234                                 

Gene name
NDAI0E00840
Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ndi  Naumovozyma dairenensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NDAI_0E00840 (NDAI0E00840)
Enzymes [BR:ndi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     NDAI_0E00840 (NDAI0E00840)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:complement(168992..169789)
Genome map
AA seq 265 aa AA seqDB search
MTTSKTVLLLKNKTEGNDRYDVLFKEKGYNPKFIPLIKHTHLPQELLHLIADESYLKNLR
YIVVTSQRTVECINEQILPQLTDKQKQLLFDKVVYTVGPTTASYLERSGFKNIKGGHEAG
NGDILSDIIVSDLSSNNKDNMHEILLLVGKIRRDIIPKKLNDNGFSIKEVIVYETDTLKD
NCENFQATLEDNCWVVVFSPQGIDDILEYIKQNNILTNHKIQIAAIGPTTEKFLNQNGIY
EMIVSPKPDAHSLLNEIERHSKHET
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaccacttctaaaacggttttacttctgaaaaacaaaacagaaggaaatgatagatat
gacgttttattcaaggaaaagggatataatcccaaatttataccattaatcaagcataca
catctcccgcaagaacttttacatttaattgctgatgaatcgtacttaaagaatttgcgt
tacattgtagttacatcccaaagaactgtggaatgtatcaatgagcaaatattgcctcaa
ttaactgataaacaaaagcagttgctatttgataaggtagtgtatactgtcgggcccacg
actgctagttatttggaacgtagtggatttaagaacataaaaggtgggcatgaagctggt
aatggtgatatattaagtgatattattgtgagcgacctttctagtaataataaggacaat
atgcatgagatcttgctattagtaggaaaaataagaagagatatcattccaaaaaaattg
aatgacaatggcttttccatcaaagaagttatagtatatgaaacggatactctcaaagac
aactgtgaaaattttcaagcgactttagaagataactgttgggttgttgtctttagtcct
caaggtatagatgatatattagaatatataaagcagaataacattttgacaaaccacaaa
atccaaattgcagcaattggaccaactacagaaaagtttttgaaccagaatggtatttac
gaaatgattgttagtcctaagcctgacgcccattctttgctaaatgaaattgagcgccat
tctaaacatgagacgtga

DBGET integrated database retrieval system