KEGG   Naumovozyma dairenensis: NDAI_0E01170Help
Entry
NDAI_0E01170      CDS       T02234                                 

Gene name
NDAI0E01170
Definition
hypothetical protein
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
ndi  Naumovozyma dairenensis
Brite
Enzymes [BR:ndi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     NDAI_0E01170 (NDAI0E01170)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:complement(232767..234182)
Genome map
AA seq 471 aa AA seqDB search
MVAEEISDSGIPRKIENVQEIMTKCQCWVKKDDDERLAEILSINTRRSPPKFYVHYVNYN
KRLDEWIDVDRINLDKEVIFPRPPDLSEDAINKQKKKKKKSPTTSLSSSVEPGASRGVTP
DNTDVMDLDNLNVQGVKHEDISQEDEIKKLRTSGSMTQNPHEVARVRNLNKIIMGEHEIE
PWYFSPYPIELTDEDVVYIDDFSLQYFGSRKQYERYRKKCTLRHPPGNEIYRDDYVSFFE
IDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDELGHHFVGYFSKEKESAD
GYNVACILTLPQYQRMGYGRLLIEFSYELSKKEHKVGSPEKPLSDLGLLSYRAYWADTLL
VLLVEHGQEITIEEISSITSMTTTDILHTAKTLNILRYYKAQHILYLSKDIADRYNELQR
KKEEELIQRSWFGSHQSLLLPNYVLHGELFYCNIVFTSALYGRLLILDNRP
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggtagcagaagagatttctgattcagggataccaagaaaaatcgaaaatgtacaggaa
atcatgactaaatgccagtgttgggtgaagaaagatgacgatgaacgcttagctgaaatt
ttatcgataaatacaagaagatcacctccaaagttttatgtacattatgttaattacaat
aaacgtctggatgaatggatcgatgtcgatcgaataaatttagataaggaagtcatcttc
cctagacctcctgatctttcagaggatgcaataaataaacagaaaaagaagaagaagaag
tcacctacaacttcgttatcgagtagtgtagaaccaggtgcatcgcgaggtgttacgcct
gataatacagatgttatggatcttgacaacttgaatgtccaaggtgttaagcatgaagat
atatctcaagaagatgaaattaaaaaattaagaacatctggttcaatgacgcaaaatcct
catgaagttgctcgtgttaggaatttaaataaaattatcatgggtgaacatgaaattgag
ccatggtatttttcaccatatcctatcgaattgacagatgaagatgttgtatatattgat
gatttcagcttacagtatttcggttcacgaaaacaatatgaaaggtatagaaaaaaatgc
acactacgacatccaccagggaatgagatatatagggatgattatgtttctttctttgaa
atagatggtaggaagcaaaggacatggtgtagaaacctctgtcttttgtccaagctattc
ttagatcataagactttgtactatgatgtcgatccatttttattctattgtatgaccaga
agggacgaattgggtcatcatttcgtgggatatttttctaaagaaaaggagtcagcagac
ggatacaatgtggcatgtatcttgactttacctcagtatcaaagaatggggtacggtaga
ctattaattgaattttcatatgagctttcgaagaaggaacataaagttggatcacctgaa
aaaccattgtcagatttaggtttattgtcatacagggcatattgggcagatacattactg
gtccttctggttgaacatggtcaagaaattactatagaggagataagttccattacatcg
atgaccacaacggatattttacatacagctaaaacattgaatattttgaggtactataag
gcacaacatatactgtacctcagcaaagatattgctgacagatataatgaattacaaagg
aaaaaagaagaagaattgatccaaagaagctggtttggaagccaccagtctttactgctt
cccaattacgttttgcatggtgaattattctattgtaatattgtattcacgtctgcatta
tatggccggttattaatcttagataacagaccatag

DBGET integrated database retrieval system