KEGG   Naumovozyma dairenensis: NDAI_0E01260Help
Entry
NDAI_0E01260      CDS       T02234                                 

Gene name
NDAI0E01260
Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ndi  Naumovozyma dairenensis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ndi00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ndi00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:complement(249563..250198)
Genome map
AA seq 211 aa AA seqDB search
MQSSKIPVVSIVACLLPEMGIGFQGSLPWRLSKEMKYFRQVTSLTKDSQKKNAVIMGRKT
WQSIPARFRPLPNRLNVVISRSFESTLREENDLPNKYFKVNSLKGAFEQLHAQFGAELER
IYIIGGGEVYNQCYDMIDHWLITALTPVETVVPEMDTFLDKDRLNSLYQECNGDLASFVP
PGTELPHVNEDGHFIDHEKGYEFEYTLYNRK
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgcaatctagtaaaatacctgtggtgagtatagttgcctgtcttttgcccgaaatgggt
attgggttccaagggtctttaccatggagactttccaaagaaatgaagtatttcagacaa
gtgacatcattaacaaaggattcacaaaagaaaaatgctgtgataatgggtaggaaaact
tggcaatcaatcccagcaagatttaggcctcttcctaatcgtcttaatgtagttatctca
agaagttttgaaagcacattacgtgaagaaaatgatctccccaacaaatattttaaagta
aattcattaaagggagctttcgaacaattacatgctcaatttggcgccgaattagagaga
atctatataattggaggtggtgaagtatacaatcaatgttatgatatgatagaccattgg
cttattacagctttgacaccagttgaaacagttgttccagagatggatacattccttgat
aaggatagacttaattcattataccaggaatgtaatggagacctagcctcatttgtccct
cccggtacagaattgccacatgttaacgaggacggtcattttatagaccatgaaaagggt
tacgaatttgaatatactttgtataataggaaataa

DBGET integrated database retrieval system