KEGG   Naumovozyma dairenensis: NDAI_0E01310Help
Entry
NDAI_0E01310      CDS       T02234                                 

Gene name
NDAI0E01310
Definition
hypothetical protein
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
ndi  Naumovozyma dairenensis
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:ndi04011]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:complement(260484..262094)
Genome map
AA seq 536 aa AA seqDB search
MASLFKPPETTRRNPKSPKLTLPPLLNHNNTTNSSSNSTNTLQLSLNMNETPKSSLLPIY
SSASSISLSPSIDGPKSSTSISSNKRRPIPPPLPPSVQRVITPTTNANKTPLYRPPPEMT
PTDISHALKELQITGQNSRTSPPLSAQSDHENNTLEKNKPLYQREDLNESVDSYYSTILS
VYEQSNSNAASPIKSPTKHIPTITTTSIDTNLQQTITDTTTDELLMNKDVDQLDEEIWNC
PNMKDQIITLGVLGEGAGGSVEKCKLKHGSKIFALKIVNTLNTDPEFQKQIFRELQFNKS
FKSDYIVRYYGMFNDVNSSSIYIAMEYMSGKSLDAVYKNLLNRGGRIGEKVLGKIAESVL
RGLSYLHEQKVIHRDIKPQNILFNEMGQVKLCDFGVSGEAVNSLATTFTGTSFYMAPERI
QGQPYSVTCDVWSLGLTILEVAQGRFPFGSDKITANIAPIELLVLILTFSPQLKDEPESN
ISWSKAFKSFIHYCLKKEPHERPSPRQMIQHPWIQGQMKKKVNMAHFIEKCWEETA
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggcttctttatttaaaccaccagaaacaacgagaagaaatcctaaatctcctaaatta
actctacctccactattaaatcacaataatactactaattccagcagtaattcaacaaac
actctccaactttcactcaatatgaatgaaacacccaaatcatctcttctaccaatatat
tcttcagcatcttccatttctttatcaccttcaatagatggtcctaaatcatcgacctcg
ataagctccaataagagaaggccaatacctcctcctttaccaccttccgttcaacgtgta
atcacacctacaaccaatgctaacaaaacacctttgtatagaccaccacctgaaatgacc
cctacagatatatcgcatgctctaaaagaattacaaataaccgggcaaaactcacgaacg
tcacccccactttcagcacaaagtgatcatgaaaataacacactcgagaaaaataaacca
ttatatcaaagggaagacttgaatgaatcggtagattcttattattcaactatattatca
gtttatgaacaaagcaacagtaatgcggcaagtcccataaaatcgccaacaaaacacata
cctacaataacaactaccagtattgataccaaccttcaacagactattacagatacaacc
acggatgaattactgatgaataaagacgttgatcaattagatgaagaaatttggaattgc
cctaatatgaaggatcaaattataacgttaggtgtgcttggagaaggagcagggggatca
gttgagaaatgtaaattaaaacatgggtcgaaaatttttgctttgaaaattgttaatact
ttgaatactgatcctgaatttcaaaaacaaatctttagagaattacaatttaataaaagt
ttcaaatcggattatattgttagatactatgggatgttcaatgatgtgaatagttcatcg
atttatattgcgatggaatatatgagtgggaaatcattagatgctgtatataagaattta
ctgaatagaggcggtagaattggtgaaaaagttcttgggaaaattgcagaaagtgtatta
aggggattatcatatttacatgagcaaaaagttattcacagagacataaaaccacagaat
attttatttaatgagatgggacaagtcaaattatgcgattttggtgtcagtggcgaagcc
gtgaattcgttagcaaccacatttacggggacatcattctatatggctccagaaagaatt
caaggacagccttatagtgttacatgtgatgtatggtcattaggattgaccatattagag
gtagcacaaggtagatttccatttggatcagataaaataacggcaaatattgcaccaatt
gaattgttagtactgattttgacatttagtcctcaattgaaagacgaaccggaatcaaat
ataagttggagtaaagctttcaaatcatttattcattattgtttgaagaaagaaccccat
gaacgtccatcaccaagacaaatgatacaacatccttggattcaaggtcaaatgaagaaa
aaagtgaacatggcacatttcattgaaaaatgttgggaagaaacagcttga

DBGET integrated database retrieval system