KEGG   Naumovozyma dairenensis: NDAI_0E02130Help
Entry
NDAI_0E02130      CDS       T02234                                 

Gene name
NDAI0E02130
Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
ndi  Naumovozyma dairenensis
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    NDAI_0E02130 (NDAI0E02130)
  Replication and repair
   03420 Nucleotide excision repair
    NDAI_0E02130 (NDAI0E02130)
Transcription machinery [BR:ndi03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     NDAI_0E02130 (NDAI0E02130)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:435627..437195
Genome map
AA seq 522 aa AA seqDB search
MTENVLKISVTQYLEEIPQQVQSRLYESPATCLAIYRLLPQLSKFFVMSMVFNNNEVSLR
DLDRWVKPDAKLQFQDAIKSMKSLHLIIPSKGNGGPLMIILNPTFRESFKNALTGGQINN
SFGIISDEDENGVVTSTLLNEYSANKWETILHFMVGTPMSSIPSGSVLNLLKHTKLMEEV
ENTGEFKITNEGFQFLLQELNSQLWTLLLQYLKLSETLNMDPVDVLNFIFMLGALEVGKG
YSIDGLSETQKIMLKDMRDYGLVFQKVSNSKTFYPTNLALMLTSDTKSIVRTASGAIESV
LNENRSGSNANENGYEPGTKKKNENTIMGTIDQVGMKNQDVPDGSLIVETNFKLYSYSNS
PLQIAILSLFVHLKFRFVNMVTGQITRESIRRALINGITAEQIIAYLETHAHPQMRRLAE
EKLEKKLELDANCKDSLQILPPTVVDQIRLWQLELDRVIAYEGSLYSDFENNTEYTTLYK
YAQDIGVLLWKDDKKRKFFVSKEGNSQVLDYAKRKLKKKQEP
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaaacgtcctgaagatatctgttactcaatatttagaggaaataccgcaacaa
gttcaatcacgactttatgaatcaccagccacatgtttagctatatatagattattaccg
caactttccaagttttttgttatgtccatggttttcaacaacaatgaagtatcacttcga
gatttagatagatgggttaaaccagatgccaagttacaattccaagatgcaattaaatcc
atgaaatcattacatcttatcatcccatccaaaggtaacggcggaccacttatgataatt
ttaaatccaacatttagagaaagtttcaaaaatgcattaaccggtgggcaaattaataat
tcattcggtattatatcagatgaagatgaaaatggtgtagtaacatcaactctattgaat
gaatattcggcaaataaatgggaaactatcttacattttatggtggggacgccaatgtca
agtattccatcagggagcgtcttgaatcttttaaaacacacgaaattaatggaagaagta
gagaatactggtgaattcaaaattacaaacgaggggttccaattcctactacaagaattg
aattcacaactctggacgttattattacaatatttaaaattatctgaaacgttaaatatg
gatccagtggatgttttaaattttatttttatgttgggtgctttggaagtcggaaagggt
tatagtattgatggattaagtgaaactcaaaaaattatgttaaaagatatgagagattat
gggttggttttccaaaaggtttccaattcaaaaacgttttatccaacaaatttagcattg
atgttaacatcagatacgaaaagtatagtaaggacagcatcaggtgccattgaaagtgtg
ttaaatgaaaatagatctggatctaatgctaatgaaaatggatatgaaccaggtacgaag
aaaaagaatgaaaataccatcatgggtactattgatcaagttgggatgaagaatcaagat
gttccagatggatctttgattgttgagaccaatttcaaattatattcttattctaactca
ccattgcaaattgctattctaagtcttttcgttcatttaaagtttagattcgttaatatg
gtcacagggcaaataacaagagaatcgattagaagagcattaattaatggtatcactgcc
gaacaaatcattgcatatttggaaacacatgctcatccgcaaatgagaagattagcagaa
gaaaaattagagaagaaattagaattggatgctaattgtaaagactcattacaaatatta
cctcccacagtagtggatcaaattagattatggcaattagagctagatagagttattgca
tatgaaggttcattatattctgattttgaaaataacacagaatacacgacattatataaa
tatgcacaagacattggtgtattgctttggaaagatgacaagaagaggaaattttttgtt
tccaaagaggggaattcacaagtgttagattatgccaagaggaaattgaaaaagaaacaa
gaaccataa

DBGET integrated database retrieval system