KEGG   Naumovozyma dairenensis: NDAI_0E02530Help
Entry
NDAI_0E02530      CDS       T02234                                 

Gene name
NDAI0E02530
Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ndi  Naumovozyma dairenensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ndi01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ndi00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:525463..526443
Genome map
AA seq 326 aa AA seqDB search
MTVTTAPSYKYYESQRLSIITAPFSGGQSRSGVEKGPKYMLNHGLQNSLTKLGWSTVITE
PLSSAILQIKKDEMDQNDRMGIVKRPNLVGKVTKLIYETVTKSLSNERFPLTLGGDHSIA
MGTVSAVIDKFPDAGLLWIDAHADINTLTSTDSGNLHGCPVSFLMGLNDKKMVPESMEWI
PGNLKPNKIAYIGLRDIDEGEKKILKNLGIAAFSMYHVDRLGINEVIEMAMRAIHPETNG
DGPIMCSYDVDALDPLYVPATGTPVRGGLTLREGLFLVERLAETGNLVGLDIVEVNPDLA
SKDDHVSDTIATSCSIARCALGETLL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgactgtaacaactgcaccatcatacaaatattacgaatcacaaagattatcgataatc
acagcccctttctcaggaggccaaagcagatccggagtagaaaagggtcccaaatacatg
ttaaatcatggtcttcaaaactccctcaccaaactaggttggtccacagttatcacagag
ccattatcttctgccattttacaaattaagaaagatgaaatggaccaaaatgatagaatg
ggcatcgttaagagaccaaacttggtagggaaagtgactaaattgatttacgaaactgtc
acgaaatcattgtctaatgaaagattcccattgactttgggtggtgatcattccattgcc
atggggactgtgtctgctgtgatcgataaattccccgatgcggggttgctttggattgat
gcacatgcagatattaatactttaacttccactgattcagggaatttacatggatgtccc
gttagtttcttaatggggttgaatgataagaagatggttcccgagtctatggaatggatt
ccaggaaatttaaaaccaaacaaaatcgcttatattggattaagagatattgatgaaggt
gaaaagaaaattttgaaaaatctaggtatagctgcattttccatgtatcatgtggataga
ctcggtattaatgaagtcattgaaatggcaatgagggctattcatcctgaaactaatggc
gacggtccaattatgtgttcctacgatgtagatgctttagatccattatatgtacctgct
acaggaactccagtaagaggtggcttgacattgagagaaggtttatttctggtggaaaga
ttggctgaaactgggaaccttgtaggcttagatatcgtcgaggttaacccagatttggca
tccaaagatgatcatgtttctgatactatcgctacaagttgttcaattgcaagatgtgcc
ttaggggaaactttattgtga

DBGET integrated database retrieval system