KEGG   Naumovozyma dairenensis: NDAI_0E02530Help
Entry
NDAI_0E02530      CDS       T02234                                 

Gene name
NDAI0E02530
Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ndi  Naumovozyma dairenensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NDAI_0E02530 (NDAI0E02530)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NDAI_0E02530 (NDAI0E02530)
Enzymes [BR:ndi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     NDAI_0E02530 (NDAI0E02530)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:525463..526443
Genome map
AA seq 326 aa AA seqDB search
MTVTTAPSYKYYESQRLSIITAPFSGGQSRSGVEKGPKYMLNHGLQNSLTKLGWSTVITE
PLSSAILQIKKDEMDQNDRMGIVKRPNLVGKVTKLIYETVTKSLSNERFPLTLGGDHSIA
MGTVSAVIDKFPDAGLLWIDAHADINTLTSTDSGNLHGCPVSFLMGLNDKKMVPESMEWI
PGNLKPNKIAYIGLRDIDEGEKKILKNLGIAAFSMYHVDRLGINEVIEMAMRAIHPETNG
DGPIMCSYDVDALDPLYVPATGTPVRGGLTLREGLFLVERLAETGNLVGLDIVEVNPDLA
SKDDHVSDTIATSCSIARCALGETLL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgactgtaacaactgcaccatcatacaaatattacgaatcacaaagattatcgataatc
acagcccctttctcaggaggccaaagcagatccggagtagaaaagggtcccaaatacatg
ttaaatcatggtcttcaaaactccctcaccaaactaggttggtccacagttatcacagag
ccattatcttctgccattttacaaattaagaaagatgaaatggaccaaaatgatagaatg
ggcatcgttaagagaccaaacttggtagggaaagtgactaaattgatttacgaaactgtc
acgaaatcattgtctaatgaaagattcccattgactttgggtggtgatcattccattgcc
atggggactgtgtctgctgtgatcgataaattccccgatgcggggttgctttggattgat
gcacatgcagatattaatactttaacttccactgattcagggaatttacatggatgtccc
gttagtttcttaatggggttgaatgataagaagatggttcccgagtctatggaatggatt
ccaggaaatttaaaaccaaacaaaatcgcttatattggattaagagatattgatgaaggt
gaaaagaaaattttgaaaaatctaggtatagctgcattttccatgtatcatgtggataga
ctcggtattaatgaagtcattgaaatggcaatgagggctattcatcctgaaactaatggc
gacggtccaattatgtgttcctacgatgtagatgctttagatccattatatgtacctgct
acaggaactccagtaagaggtggcttgacattgagagaaggtttatttctggtggaaaga
ttggctgaaactgggaaccttgtaggcttagatatcgtcgaggttaacccagatttggca
tccaaagatgatcatgtttctgatactatcgctacaagttgttcaattgcaagatgtgcc
ttaggggaaactttattgtga

DBGET integrated database retrieval system