KEGG   Naumovozyma dairenensis: NDAI_0E02820Help
Entry
NDAI_0E02820      CDS       T02234                                 

Gene name
NDAI0E02820
Definition
hypothetical protein
Orthology
K11874  
ubiquitin carboxyl-terminal hydrolase 16 [EC:3.4.19.12]
Organism
ndi  Naumovozyma dairenensis
Brite
Enzymes [BR:ndi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     NDAI_0E02820 (NDAI0E02820)
Peptidases [BR:ndi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NDAI_0E02820 (NDAI0E02820)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:598119..599606
Genome map
AA seq 495 aa AA seqDB search
MTKYTYLVPNDRQTQWLNVLLAKNGGALKKITGLTILGVSLYIVSPTLIISLLRTLGLRD
KDTKESCRLDRTTMGLINARNDCFINSSLQALVPLSSFTVYLNSILSKLQEDKNLSLPLH
KNLAKTVYELQKLIVDSESYSAELIISTMEHIFKGTISRQQNDAHEFTQLLLETLFKELA
VLPKGVIEVPMKGVVGNHLICIRCGHISQIKEEMFSIYELNVPQCSSSKLTDIIHNNQLE
KIEGYSCLYCEINMILKNENYRNSDGFTGDDEEKRKLRYLKEVFLNNLMINQELPDDIMH
YIKSYKRGYCDISKMEKSDIFRKRRLLQCPKVLLIHLSRSMYNGMAYTRNPCNVEFENIL
ELEEEQMLQSSPGEKTFINSNSKIRYELKSLVKHTGSHYQGHYQCYRHKPKLRINKENGE
IINRSSVIDNNLLKDDEVEVEVKEENTVPSQSFKKIKSVETYPFWKLSDTSIEESTVKKV
LNEKKSVYMLYYERI
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaatatacgtatttggttccaaatgatcgtcagactcaatggttgaacgttctc
ttagcgaagaatggaggcgccctcaaaaagatcactggactaactatattaggtgtatca
ctttacattgtatcccctacattaattatttctcttttgagaacattaggtcttcgagat
aaggataccaaggaatcatgtcgattggataggactacgatggggttaataaatgccagg
aatgattgcttcataaattcatcacttcaagctctagttcccttgtcatcgtttactgta
tatttaaattccatactatcaaaattacaagaggataagaacttaagcctaccattacat
aagaatctcgccaagacagtttatgaactgcaaaaattaattgttgattcagagtcttat
tcagcagagttgataatatctacgatggagcatatttttaaaggaacgatatcccggcag
caaaatgatgcccatgaattcactcaattattattagagacgttgtttaaggaattagcg
gtgcttccaaagggggttatagaagtaccaatgaagggagtggtgggcaatcatttaatc
tgtattagatgtggccatatttcgcaaatcaaagaggagatgttttcaatttatgaactc
aacgtaccacaatgttcttcaagcaaattaacggatattatccataataaccaattagaa
aagattgaaggttactcatgtttatattgtgagataaatatgatactaaagaacgagaat
tatagaaatagtgacggctttactggagatgatgaagaaaaacggaaattgagatatctt
aaagaagtctttttgaacaatttaatgataaaccaagaattaccggatgatataatgcat
tatattaagtcttataagagaggttattgtgacatatcgaagatggaaaagtctgacata
tttcgaaaaaggagactgctccagtgtccaaaagtattattaattcatttatcgcgatca
atgtataatggaatggcatatactagaaacccatgtaatgtcgagtttgaaaatatactt
gaactagaagaggaacaaatgttgcagagcagtcctggcgagaagacatttattaattca
aacagtaaaataagatatgaattgaagtcgttagtgaagcatactggttcacattatcaa
gggcactaccaatgttatagacataagcctaaattacgaattaataaggaaaatggtgaa
ataattaatcgatcttcagtaatcgataacaatctgttaaaagatgacgaagtggaggta
gaagtcaaggaagaaaatacagtaccttcccaatctttcaaaaagattaaaagtgtagaa
acatacccattttggaaattatctgatacgtcgattgaggaatcaactgtgaagaaagtt
ttaaatgaaaagaaatcagtctatatgctctattatgaacgtatttaa

DBGET integrated database retrieval system