KEGG   Naumovozyma dairenensis: NDAI_0E03610Help
Entry
NDAI_0E03610      CDS       T02234                                 

Gene name
NDAI0E03610
Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ndi  Naumovozyma dairenensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NDAI_0E03610 (NDAI0E03610)
Enzymes [BR:ndi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     NDAI_0E03610 (NDAI0E03610)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:complement(777607..779238)
Genome map
AA seq 543 aa AA seqDB search
MLSPLSKLPPNAKVGVVGGGVSGLMFTYFLSKLRSDIKITLFEGEKRTGGWINSWNTADQ
NGASVMLERGPRTLRGVSDGTVVIMDTMNDLGKSDSIRCVEKYATANRKFLLGPNDKLVQ
VPNSFGSFLKFATSPLSKGLFTGIAGEMFRKSSSTPGKDESVRTMLNRRYGNDFIASNLM
SAIYHGIYADDISTLSAQKTSGKVFYTELKHGSVLRGSIKEYIRNRFGKKQPETLSGCLK
LYQRAFNKDTGALLKLSNHLKKYPMLGFVGGLETFPKTIRKELDNIRNVEIVTGSAVTKM
YKDSKNSTMSVKLSTNERIDGFDHLRITVTPQILSTLITSTYGDLIKDLKKVKSNTVILI
NYYLPNKEIIRPEIQSFGYLIPQSNTNPANILGVIFDSVIEKNFKSFNIDDANPSRLEVS
SSGQSSELQYTKLTIMVGGHLLNENGKTKIPAEATCLADVKSALETHLNVSREDLDNGLW
VYTVAKECFPHYFIGYKDWQNKLEKTLLTTYDNKISLGGMGFAKGPGVPDVIVDGLQDAL
KLK
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgctttcaccactaagtaaattaccaccgaatgcgaaggttggtgttgtaggtgggggt
gtatcaggtctcatgtttacttattttctttccaaattaaggtcggatattaaaattaca
ctgtttgaaggagagaaacgtacaggtggatggatcaattcatggaacactgctgatcaa
aatggggcgtcggtcatgctcgagagaggacctagaacattacgaggtgtctctgatggg
actgttgtaattatggatacaatgaacgatcttgggaaatcagatagtattagatgtgtt
gagaagtacgctacagctaataggaagttcctgctgggacctaatgataaattggttcaa
gtaccgaattcgtttggtagctttttaaaatttgcaaccagtcccctaagtaaaggttta
tttactgggatagcaggtgagatgtttaggaaaagtagttctacacctggcaaggatgaa
agtgtcagaaccatgctgaataggaggtatggtaacgatttcatcgcttccaatttgatg
agtgctatataccatgggatttatgctgatgatatttctacgttgagtgctcaaaagaca
tccggaaaagtattctatactgaattaaaacatggttctgtcctaagaggatccattaaa
gaatatatcagaaatcgatttgggaaaaaacaaccagaaacgctcagtggttgcctaaaa
ttatatcaaagagcatttaataaagatacaggagccttattaaaattatctaaccatttg
aaaaaatatcccatgctaggttttgtgggaggtttagagacatttccaaaaacaatcagg
aaagaacttgacaatataagaaatgttgaaattgttaccgggagcgcagttactaaaatg
tataaggattccaaaaactcaaccatgtctgtaaaattatcaacaaacgaacgaatagat
ggatttgatcacctaagaattaccgtgacgccacaaattttatctactttaataacttct
acctatggagacctcattaaagatttaaaaaaagtgaaatccaatacagtgattttaata
aattattatttacctaacaaagaaataatccgccctgaaatccaaagttttggatattta
attccgcaatccaatacaaaccctgctaacatcttaggtgtcatttttgactcggttatt
gaaaagaacttcaaaagctttaatattgatgatgctaacccatcgcgtttggaagttagt
tcatcgggccaaagttcagagttacaatatactaagttgactattatggttggtggccat
ttactcaatgaaaatggcaagactaagattccagctgaagctacttgtttggctgatgtt
aaaagcgcattagaaacacatctaaatgtttcgagggaagatctagacaatggtctatgg
gtatacacagttgcaaaagagtgtttcccacattattttattggatacaaagactggcaa
aataaactagaaaagactttactaactacatatgataataagatttcgttaggtgggatg
ggatttgcaaaagggccaggtgtacctgatgttattgttgatggattacaagatgcattg
aagttgaaataa

DBGET integrated database retrieval system