KEGG   Naumovozyma dairenensis: NDAI_0E04040Help
Entry
NDAI_0E04040      CDS       T02234                                 

Gene name
NDAI0E04040
Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
ndi  Naumovozyma dairenensis
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    NDAI_0E04040 (NDAI0E04040)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    NDAI_0E04040 (NDAI0E04040)
   04113 Meiosis - yeast
    NDAI_0E04040 (NDAI0E04040)
Protein phosphatases and associated proteins [BR:ndi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     NDAI_0E04040 (NDAI0E04040)
Ubiquitin system [BR:ndi04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     NDAI_0E04040 (NDAI0E04040)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:900685..903036
Genome map
AA seq 783 aa AA seqDB search
MLFQPELGAVPRPNISSTNDPTVNTDETGPSSTWKKPSVSFLNGDTFIPSSAVLFLSETS
MLKLEEVIEHAIEQLNYDTAEFYAELLFAQCSNLENSNIHKIKSIYLYTLALFLNQNYHT
SMHVSKDYKHSDIGIAYLYGKCALKLSRKIKEAIDSLVRLKGVFNGNSNAENVQLFPLIH
FPNVATIDCLIAKLYSKLDRKHESSLFHSGALNQDPYLWESYTELCKMKVSIDIKALFMG
TSQKSSNLRPKKSNRIVKSTVSSSSSTSSLSLSLLHKGSNNIPTVEVTPFNISAPWYNEV
PESSINNLNRNLNISRISPARHGKVNDPKNIADGWPTISRNANNLNNNNNNINNESSPGT
QRGSSIFSAKQPTSPSVKQPTISSLAKINSNRNRLLTTPPSKLNSNHDQRARYKTLKNIS
YNTSSNNANMSSTIRKKLLLESDNPNGNMFDAQNDEPLNNLLYSFALILKTSSQYNSYKA
IRLINSLLPTHIRDEMPWCQSQLGMLHFEIVNYEMSLKYFEKLRKLQPTRLKDLETYSTL
LWHLHDKIKLTVLSNELLKEFKNEPQTWCCLGNLFSLQKDHKEAIKAFEKVTKLDPTFTY
GYTLQAHEYLSDDSFDLAKNYFRKAVSTDSQHYNAYYGIGMCSMKLGEFEHALLYFEKAR
SINPSNVILICCCGVAFEKLSYPEKALSYYELACQVQPSSSLAKFKRAHLLYSMANYPLA
LECFEELTKLAPEEATVHFILGQLYNIMGRKKDAVKEYTIAMNLDPKGNQVILEALEKCH
EQE
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgctgtttcaaccagaactcggagctgtaccacgaccaaatatttcaagcactaatgat
cccacggttaatacagacgaaactgggccctcatcaacgtggaagaaaccgtcagtttca
ttcctaaatggtgatacatttatcccgtcgtctgcagttttgtttttatctgaaacatcc
atgttaaagttagaagaagttattgaacacgctattgaacagttaaactatgatacagct
gaattttatgcagaattattgttcgctcaatgttcaaatttggaaaactcgaatattcat
aagattaaatccatatatctttatacgttggctcttttccttaatcagaattatcataca
agtatgcatgtctcaaaagattataagcattcagatatcggtattgcgtatctatatggg
aaatgtgctttaaagctttctcgaaagattaaggaagccattgattctctagtaagatta
aaaggggtctttaatggtaatagcaacgcggaaaatgtacaattatttccattgatccat
ttcccgaatgtagcaactatagattgcctaatagcaaaattgtattctaaactagatagg
aagcatgaaagctcacttttccattcaggtgcattgaatcaagatccatacctatgggaa
tcatacactgaattatgtaagatgaaagtatccattgatatcaaagcattattcatggga
acaagccaaaagagttcaaatttgagaccgaaaaaatcaaatcgaatagttaaatctaca
gtatcatcgtcgtcctcgacatcgtcactttctttgtcattattacataaaggatccaat
aatattcccactgtagaagtaacgccatttaacatatcggcaccttggtataatgaagtt
cccgaatcatccatcaacaatctgaacagaaacttgaatatatcaagaatatcaccagca
agacatggaaaggtaaacgatccaaagaatatcgccgatggatggccaacgatatcgagg
aacgctaataatctcaataataataacaataatatcaataatgagagttcgccgggaact
cagagaggatctagtattttttctgcaaaacaacctacttcaccttccgttaaacaacct
actataagttcccttgctaaaataaattccaatagaaacagacttttgacaacaccacca
tccaagttgaattctaaccatgatcaaagggcaagatataagacactaaaaaacatcagt
tataatacaagctcaaataatgccaatatgagctctaccatcagaaaaaaattacttctt
gaatcagataatccgaacggtaatatgtttgacgcacaaaatgatgaaccattaaataat
ctactttattcctttgcacttatattgaagacatcatcacaatataactcttacaaagcc
attagattaattaattctttattacccactcatatacgggatgaaatgccatggtgtcaa
tcacaattaggtatgttacatttcgaaattgtcaattatgagatgtcattgaaatatttt
gaaaaattaaggaaattacaaccgactagattaaaagatttagaaacttactctacgtta
ttatggcatttacatgataagataaaactaactgttctatcaaatgaattattaaaggaa
tttaaaaatgaacctcaaacttggtgttgtttgggtaatcttttctcattacaaaaagat
cataaagaagctataaaggcttttgaaaaagttacaaaactagatcctacgttcacatat
ggttacactttgcaagcacatgaatatttatcagatgattcatttgatttggcaaagaat
tatttcaggaaagcagtatctactgactcacaacattataatgcatattatggtatcggt
atgtgttctatgaaattaggtgaatttgaacatgctttactttattttgaaaaggcaaga
tcaattaatccaagtaacgtaattttgatttgttgttgtggtgtggcgtttgaaaagtta
tcatatccagagaaagctttgtcttattatgaattagcttgtcaggtacaaccatcttca
tctttggctaaatttaaaagagctcatcttttatattcgatggctaattatccattggca
ttggaatgttttgaagagttgacaaaattggcacccgaagaggcaactgtacatttcatt
ttgggtcaattatataatataatgggtaggaaaaaagatgctgttaaagaatatactatt
gcgatgaatttggatccaaagggaaatcaagtgattttggaagcattagaaaaatgtcat
gaacaggaatag

DBGET integrated database retrieval system