KEGG   Naumovozyma dairenensis: NDAI_0E04400Help
Entry
NDAI_0E04400      CDS       T02234                                 

Gene name
NDAI0E04400
Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
ndi  Naumovozyma dairenensis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    NDAI_0E04400 (NDAI0E04400)
Translation factors [BR:ndi03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    NDAI_0E04400 (NDAI0E04400)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:complement(996334..997137)
Genome map
AA seq 267 aa AA seqDB search
MSWDDEAVTGSMGMDDEEVLLESWDAEEEPIMESWDAEVVPKEETKPKSKASTSGTKNKN
GKKSKETTPGIALDALDPKMRRELLKKAELESDLSNAADLLGSLDLAEEHPRARQLKEQQ
EAALLMMSQPVLTKETEFDVHPLFQAETKKDYQDLRKALSKSIVKMHDKSPLNYSSSLAI
DLIRDVAKPMSIESIRQTVATLNVLIKEKEKEERQARLARVRGGTATGGAGKKKAKVKTN
LGGAFKKDQDFDLDDMNYDNFGDDDFM
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgggatgatgaagctgtcactgggtccatgggtatggatgatgaagaagttcta
ttagaatcttgggatgccgaggaagaaccaatcatggaatcgtgggatgctgaagtggtg
ccaaaagaagaaacaaaaccaaaatcaaaggcttctacttcgggtacaaagaataagaat
ggtaaaaagagtaaggaaacgacacccggtatagctcttgatgcacttgatccaaagatg
cgtagagaattattgaaaaaggcagagttggaatctgatttaagtaatgctgctgattta
ttagggtcattagatttagctgaagagcatccaagagcccgtcaattgaaggaacaacaa
gaggctgcattattaatgatgagtcaaccagtattaactaaggaaactgagtttgatgtt
catccattattccaagctgaaactaagaaagattatcaagatttacgaaaggcattatct
aaatccattgttaagatgcatgataaatcaccgctaaattattcttcatcattagccatt
gacttgattagggatgtagctaaaccaatgtccattgagtcaatcagacaaactgttgcc
actttaaatgttttaattaaggaaaaggagaaagaagaacgacaagctcgtctagcccgt
gttagaggtggtacagcaacaggtggtgctggtaagaagaaggctaaggtgaagaccaat
cttggtggtgcattcaaaaaggatcaagattttgatctagatgatatgaactacgacaat
ttcggtgatgatgatttcatgtaa

DBGET integrated database retrieval system