KEGG   Naumovozyma dairenensis: NDAI_0E04730Help
Entry
NDAI_0E04730      CDS       T02234                                 

Gene name
NDAI0E04730
Definition
hypothetical protein
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
ndi  Naumovozyma dairenensis
Brite
Enzymes [BR:ndi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     NDAI_0E04730 (NDAI0E04730)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:1066657..1069299
Genome map
AA seq 880 aa AA seqDB search
MVITNKPADTNEKFVKSGNIPTLSTDCKSNSNSDTDKSSPMSSSKRRSPSILKNLVIDDN
IHSKAQQLYLNSNGTDASTDEDVARRPRMRRNQDRAKISYVFKRGNSRQNSSSRRVKAKH
TQLANQVNEQQEYSPYNHTLPLGLNDANKLNENVQFNPIHNDSIDTSSLNDTTNHDTTPL
IYNYDYSTIKIKYDPLKYFNFQKNLEFSSSSLYTNSEEQQQEEHEEQEDDVKKFQKISKQ
LQINSSNDNMININPQQKYSHHFPYNGAILKQKDYSTSNTFPNSNDRDFFLKLLKHSKHA
SYFNSNTTLANHSNRNDKSIIGKNKIRSKLKITTVVNSSIEYIHINNYEIKTWYKSPYPL
STNKNKILYICELCLKNSNSRQTHYNHQFKCTNHRNNNNIKTPPGNQIYFAQINGLSIWE
IDGRENIEYCRNLCLLSKLFLNSKTLYYDVEPFIFYVLMKQTKDSYDYNFIGYFSKEKSN
SLNYNLSCILTLPIYQRMGYGNFLMEFSYLLSRREFKLGTPEKPLSDLGLLSYRNFWKIK
IAKTLLLIKNAFEQSSSSSSSSSSSSSQAQLTLKTITLNDLANLTGMTTTDVIFGLEQLK
LLYYHTPSVPSPASSQFSPNKEEVKIKIKIKSWSILQELVDNWDSKNYPNVEPELLIWKP
MIFGPSFGINTLQPPPPISPPLQHHQQSDSISLNTTSGDFFSDHINTLTNFMSDDINDPR
DLETVTLESLLKKNEALQKISDLPKSSNDLGETLDHAGGDEEWKLCYKEPILPSTTIAIT
TMNSGTNVINYNNNNNNNSSNKSKNKRPQKAIFSSEIQITEQEGEDDEPDDDIGDISNTL
EDIDNNDDDDQEYSSNDVDEDDEEDDDEEEEENLVSDEEV
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atggtgataacaaacaaaccggctgatacgaatgaaaagttcgtaaagtcaggtaacatt
ccaactctctctacagactgcaagtcaaattcaaattctgatactgataaatcctctccg
atgtcttcttcgaaaagaagaagtccttccatcttgaaaaacctagtcattgacgacaat
attcattctaaagctcaacaattgtacttaaactcaaatggtactgatgcttctactgat
gaggatgtagcgaggaggccaagaatgagaaggaatcaagatagggcaaagatctcatat
gtctttaaaagaggaaatagtcgtcaaaatagtagtagtagaagagtaaaagcgaaacac
acacaattagctaatcaagttaatgaacaacaagagtattctccatataatcatacacta
cctttgggtttgaatgatgctaataaattgaatgagaatgtccagttcaacccgatccat
aacgattcaattgatacctctagtttaaacgataccactaatcatgatacaaccccattg
atatacaattatgattattcaacaattaaaataaagtatgatccattgaaatattttaat
tttcaaaaaaatttggaattctcatcatcttctttatatactaatagtgaagaacagcag
caagaagagcacgaggaacaagaagatgacgtcaaaaagttccaaaaaatatcaaagcaa
ttacaaattaacagtagtaacgataacatgataaatattaatccccaacagaaatactca
catcacttcccttataatggcgccatcttaaaacaaaaggattattccacttcaaataca
tttcctaattcaaatgatagagatttttttctaaaattattgaaacactctaaacatgcc
tcttatttcaattcaaatactactttagcaaatcattctaatagaaatgataaatcaata
atcggaaagaataaaattagaagtaaactgaaaataacgacagtcgtaaattcgtcaatt
gaatacattcatattaataattatgaaattaaaacatggtataaatccccatacccatta
tcaacgaataaaaataagattttatacatctgtgaactttgcttgaaaaattccaactcg
aggcaaacccattataatcatcaattcaaatgtacaaatcatcgaaataataataacatt
aaaactcctcctggaaatcaaatctattttgctcaaataaatggactatcaatttgggaa
attgatggtcgtgaaaatattgaatattgtagaaacttatgtctcttgtcaaaattgttc
ctaaactctaaaactttatattatgatgtggaacccttcattttttatgtattaatgaaa
cagacgaaagactcatatgattataatttcattggttatttttcaaaagaaaaatctaat
tctctaaattataatttaagttgtatattaactttgccaatttatcaaagaatgggatat
ggaaattttttaatggaattttcttatttattgtcaagaagagaattcaaattaggtact
ccagaaaaaccattgagtgatcttggtttattatcatacagaaatttctggaaaattaaa
atcgcaaaaactttattactaattaaaaatgcatttgaacaatcatcatcatcatcatca
tcatcatcatcatcatcatcacaggctcaattaacattgaaaacaatcaccttgaatgat
ttggctaacttaacaggaatgactacaaccgatgtgatttttggtcttgaacaattaaaa
ttactatattatcatactccatcggtaccatcacctgcatcctcacaattttcaccgaat
aaagaggaagttaaaatcaaaatcaaaatcaaatcatggtcaattctacaagaattagta
gataactgggactccaaaaattatccaaatgttgaaccagaattattaatttggaaacca
atgatttttggtccatcttttggtataaatacattacaaccaccgcccccaatatcaccg
cctttgcaacatcatcaacaatcagactcgatatcactaaatacaacttcaggtgatttt
ttcagtgaccatattaatactttaaccaattttatgagtgatgatattaacgacccaaga
gatctagaaactgtaacattggaatcactattaaagaaaaatgaggcacttcaaaaaata
tctgaccttcctaagtcctctaatgatttgggagaaacccttgaccatgctggtggtgat
gaagaatggaaactatgttacaaagaaccaatattaccgagtactacgatcgctattact
actatgaatagtggaacaaatgtaataaactataataataataataataataatagtagt
aataagagcaagaataaacgaccacaaaaggcgatattctcctccgaaatccaaataacg
gagcaagaaggggaagatgacgagcctgatgacgatattggagacataagtaatactcta
gaggacatagataacaacgatgatgatgatcaagaatatagtagtaacgacgtagacgaa
gacgatgaggaggatgatgatgaagaagaagaagaaaatctagtgtctgatgaggaagtg
taa

DBGET integrated database retrieval system