KEGG   Naumovozyma dairenensis: NDAI_0E04820Help
Entry
NDAI_0E04820      CDS       T02234                                 

Gene name
NDAI0E04820
Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ndi  Naumovozyma dairenensis
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NDAI_0E04820 (NDAI0E04820)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NDAI_0E04820 (NDAI0E04820)
Enzymes [BR:ndi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     NDAI_0E04820 (NDAI0E04820)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:complement(1083749..1085434)
Genome map
AA seq 561 aa AA seqDB search
MPTSVLDSSEKEFYDVQNQIEKSCADIESWWSQPRWSSTKRAYTARDIAIRRGSFPSVEY
QSSLMATKLFKLLQNHYNNNTVSKTFGALDPVQVTQMAKYLDTIYVSGWQCSSTASTSNE
PGPDLADYPMDTVPNKVEHLFKAQLFHDKKQFQDRAQCSSPNDLKKLGPAIDYMRPIIAD
ADAGHGGLTAVFKLTKMFIERGAAGIHIEDQTSTNKKCGHMAGRCVIPVQEHINRLTTIR
MCADILNSNLILVARTDSEAGTLISSTIDVRDHYFIVGATNPDVKISFADVMNDAINKGY
DSNQLETLEKEWCEKAGLKLFHEAFRDEVLSDNKLSKQEKDEKIKKFNAQVGPLTETSHN
DAQELGKQLLGHKIHFNWELPRVREGLYRYRGGTQCAVMRARAFAPYADLVWMESNYPDY
EQAKEFAEGVKAKYPNQWLAYNLSPSFNWTKVMSPDDQKTFIQRLGDLGYIWQFITLAGL
HTTALASHNFTRDFAEYGMMAYAQNVQQKEMDNGVDVLKHQKWSGAEYIDGLLKLAQGGV
SATAAMGKGVTEDQFKEVSKL
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgccaacttcagtactagactcatctgaaaaggaattctacgacgtacaaaaccaaatc
gagaaatcttgtgccgatatagaatcatggtggtctcaaccacgttggagttccacaaag
agagcatacacagcacgggatatcgccatcagacgtggttccttcccatccgttgaatac
caatcatcgctaatggctaccaaattattcaagctattacaaaatcattataacaacaat
actgtctccaagacattcggtgcgttggatccagtccaagttactcaaatggctaaatat
cttgataccatctatgtctccggttggcaatgttcctctaccgcgtcaacatctaatgaa
ccgggcccagatttagctgattatccaatggatacagtccccaataaggtggaacatctc
ttcaaagctcaattgttccatgataagaaacaattccaagatagagctcaatgttcatct
ccaaatgacttgaaaaaattgggtccagccatcgattatatgagaccaattatagctgat
gctgatgcaggtcatggtggtcttactgctgttttcaaattgaccaaaatgttcattgaa
cgtggtgctgcaggtattcatatcgaagatcaaacttctactaataagaaatgtggtcac
atggctggaagatgtgtcatcccggtgcaagaacatattaatagattgactaccattaga
atgtgtgctgatatcttgaattcgaatttaatcttagtcgctagaactgattcagaggct
ggtactttgattagttccaccattgatgttagagatcattatttcattgttggtgctact
aaccctgacgttaaaatctcctttgctgacgttatgaatgatgctataaataaaggttat
gattccaatcaattagaaacactggaaaaggaatggtgtgaaaaggctggtttgaaatta
ttccatgaagctttccgcgatgaagttttatctgacaataaattatctaagcaagaaaag
gatgagaaaatcaagaaatttaatgctcaagttggaccattaactgaaacttctcataat
gatgctcaagaattaggtaaacaattattaggtcataaaatccatttcaattgggaatta
cctcgtgttagagaaggtttatatagatacagaggcggtactcaatgtgctgtcatgaga
gctcgtgcatttgctccatatgctgatttagtttggatggaatctaattatcctgattat
gaacaagcaaaggaatttgctgaaggtgttaaggctaaatatccaaatcaatggttagct
tataatttatctccatctttcaattggaccaaagttatgtcccctgatgatcaaaaaact
tttattcaaagattaggtgatttaggttacatttggcaatttatcactttagcgggtcta
catactacagcattagcttctcataacttcacaagagattttgctgaatatggcatgatg
gcttatgctcaaaatgttcaacaaaaggaaatggataatggtgttgacgtattaaaacat
cagaaatggtccggtgctgaatatattgatggtttattgaaattggctcaaggtggtgtc
agtgctaccgctgctatgggtaaaggtgttacagaagatcaattcaaggaagtgagtaaa
ttataa

  All links  
No link information was found.   
DBGET integrated database retrieval system