KEGG   Naumovozyma dairenensis: NDAI_0F00990Help
Entry
NDAI_0F00990      CDS       T02234                                 

Gene name
NDAI0F00990
Definition
hypothetical protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ndi  Naumovozyma dairenensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NDAI_0F00990 (NDAI0F00990)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NDAI_0F00990 (NDAI0F00990)
   00630 Glyoxylate and dicarboxylate metabolism
    NDAI_0F00990 (NDAI0F00990)
Enzymes [BR:ndi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     NDAI_0F00990 (NDAI0F00990)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:complement(239502..241166)
Genome map
AA seq 554 aa AA seqDB search
MVKVNLENVKLYAEIDSTPQFSSKTTIADILTKDALEFIVLLHRTFNSKRIELLKNRELI
QSELNSNEYQFDFLPETQKIRDDPTWQGAIPAPGLINRSSEITGPPLRNMLVNALNSEVN
TYMVDFEDSSSPTWENMIYGQVNLYDAIRNQIDFITPRKQYKLKDHISKLPTIIVRPRGW
HMVEKHLYVDDEPISASIFDFGLFFYHNAKELIEIGRGPYFYLPKMEHHLEVKLWNDIFC
VAQDYIGMKRGTIRATVLIETLPAAFQMEEIIYQIRQHSSGLNCGRWDYIFSTIKKLRNK
SEHVLPNRDQVTMTSPFMDAYVKRLINTCHRRGVHAMGGMAAQIPIKDDPIANAKAMEKV
HNDKWREMTNGHDGSWVAHPALAPICNEVFSNMGTANQIYRIPEVTIVAKDLLNTDIKGA
EVTTKGIRDNLDIGLQYMEAWLRGSGCVPINHLMEDAATAEVSRCQLYQWVKHNVILKDT
GKPITSDLTSTILAEEVEKLSASSPVGVANKFSLAAKYFLPEITGEIFSDFLTTLLYDEI
ITPTQSPVDLSKLQ
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggttaaagtcaacttagaaaacgtcaaactatacgctgagattgattccacaccccaa
ttttcttctaaaacgacaattgcagatattttaactaaagacgctcttgaatttatcgtt
ctattacaccgaaccttcaattctaaacgtattgaattattgaaaaatagagagctaatt
caatcagaactaaattcaaatgaatatcaatttgattttttaccagagacgcaaaaaatt
agggacgatccaacttggcaaggtgccattccagcaccaggattgattaataggtcttct
gaaattacaggtcctccattaagaaacatgttagttaatgcattgaattcagaagtcaac
acttacatggttgatttcgaagattcttcttcgccaacttgggaaaacatgatttatggt
caagttaatctatacgatgctatcagaaatcaaatcgattttattactccaagaaaacaa
tacaaattgaaagatcatatttccaaattaccaacgataatagttagaccacgtggttgg
catatggttgaaaaacatctttacgtggatgatgaaccaattagtgcatcgatttttgat
ttcggattatttttttatcataatgctaaggagttaattgaaattggtagaggcccttat
ttttatttacccaagatggaacatcacttagaagttaaattatggaatgatattttttgt
gttgctcaagattatatcggtatgaaacgtggtactataagagctactgtgttgatcgaa
actttaccagctgctttccaaatggaagaaatcatttatcaaattagacaacattcaagt
gggttgaattgtggacgttgggattatattttttcaactatcaaaaaactaagaaataaa
tcagaacatgtcttaccgaatagagatcaagttacaatgacatcaccatttatggatgct
tacgttaagagattaatcaatacatgtcatcgtagaggggttcatgcaatgggtgggatg
gcagcccaaattccaattaaagatgatccaattgcgaatgctaaagctatggaaaaggtt
cataatgataaatggagggaaatgaccaacggtcatgatggttcttgggttgctcaccct
gcgttagcaccaatatgtaatgaagtgtttagtaatatgggtacagcaaaccaaatttat
cgtattccagaagttactattgttgctaaagatttgttgaataccgacattaaaggtgct
gaagtcactacaaagggtattagagataatctagatatcggattacaatatatggaagct
tggttaagaggttcagggtgtgttcctatcaaccatttaatggaagatgcggccaccgca
gaggtctcacgttgtcaattgtatcaatgggttaaacataatgtgattttaaaggacaca
gggaaacctatcacttctgatttaactagtaccatattggctgaagaagttgaaaaacta
tccgcatcaagtccagtgggggttgcaaataaattctctttagcagctaagtacttttta
cccgaaataacaggcgaaatatttagtgatttcctgaccactttgttatacgatgaaatt
atcaccccaactcagtcgccagttgatctaagcaaattgcaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system