KEGG   Naumovozyma dairenensis: NDAI_0F01650Help
Entry
NDAI_0F01650      CDS       T02234                                 

Gene name
NDAI0F01650
Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
ndi  Naumovozyma dairenensis
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    NDAI_0F01650 (NDAI0F01650)
Enzymes [BR:ndi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     NDAI_0F01650 (NDAI0F01650)
Protein kinases [BR:ndi01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   NDAI_0F01650 (NDAI0F01650)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:403635..404738
Genome map
AA seq 367 aa AA seqDB search
MNAGTATQPTGIDNQQQQQQQHPHTQHEQQIQQQHLVNSKLPQKSLESKGKYTLQDFQIM
RTLGTGSFGRVHLVRSVHNGRYYAIKVLKKHQIVRMKQIEHTNDERRMLKLVEHPFLIRM
WGTFQDSRNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLHHHNIIYRD
LKPENILLDRNGHIKITDFGFAKEVETVTWTLCGTPDYIAPEVIATKPYNKSVDWWSLGI
LIFEMLAGYTPFYDSTPMKTYEKILQGKVIFPTFFHPDVVDLLGQLITADLTRRIGNLQS
GSKDIKCHPWFSEVVWEKLLAKDIETPYEPPITSGVGDTSLFDQYPEEHFDYGIQGDDPY
AEYFNDF
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctggaactgctactcaaccaactggtatcgataaccaacaacaacagcaacag
caacatcctcatacacaacatgaacagcaaatacagcaacaacatctagttaattccaaa
ttaccgcaaaaatctttggaatctaaagggaagtataccttacaagatttccaaattatg
aggactttaggtacaggttcctttggtagagttcatttggttagatctgttcataatggt
agatattatgccattaaagttttgaagaaacaccaaattgttcgcatgaagcaaattgag
catactaatgatgaacgacggatgttaaagttagtggaacatccgttcttaattcgaatg
tgggggactttccaagattcaagaaatatctttatggttatggattatatcgaaggtggt
gagttgttctcattattaagaaaatctcaaagatttcctaatcctgtagctaaattttat
gcggctgaagttacattggccttagaatatctacatcaccataatatcatatacagagat
ctaaaacccgaaaatattttattagacagaaatggacatatcaagataacagactttgga
ttcgccaaagaagtggagactgttacatggactttatgtgggactcccgattatatcgca
ccagaagtcattgcgacgaaaccttataacaaatctgttgattggtggtcgttagggatt
ttgatttttgaaatgttagctggttatacaccattttatgattctactccaatgaaaact
tatgaaaagattctacaaggtaaagttatattcccaactttcttccaccctgatgttgtt
gatttattaggtcaattaattacagcagaccttacaagaagaattggtaatttacaaagt
ggttctaaggatattaaatgtcacccatggtttagcgaggttgtctgggaaaagcttcta
gctaaagatatcgagactccttacgagccgcccatcacttcaggcgtcggtgatacttca
ttgtttgatcaatatccagaagaacattttgattatggtatccaaggagatgatccttat
gcagaatattttaatgatttttag

DBGET integrated database retrieval system