KEGG   Naumovozyma dairenensis: NDAI_0F02400Help
Entry
NDAI_0F02400      CDS       T02234                                 

Gene name
NDAI0F02400
Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ndi  Naumovozyma dairenensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:ndi01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ndi00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ndi00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ndi00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:complement(575166..576662)
Genome map
AA seq 498 aa AA seqDB search
MSAILRAIPKISRSSGVIASTRSQINNQLRYQLHLRATYASSSYPPHMIIGMPALSPTMA
QGNLAVWTKKEGDSLSPGEVIAEVETDKAQMDFEFQDEGFLAKILVPEGTKDIPVNKPIA
VYVEEENDVPAFKDFKLDEVTGSTSNGSNDNTAKQQKEDGNEASKKLEDKSEEKPKSKPK
SKKTTATTDKDATVNTSRIIASPLAKTIALENGIALKNMKGSGPHGRIVKADVMEFLEKN
KNAPSSSTSSGGPTLSVSSTATSTSYEDMEISNMRKIIGDRLLQSTQSIPSYIISSKISV
SKLLKLRKSLNSTANDKYKLSINDILIKAITVAAKRVPDANAYWMPDGKNIIRRFKNVDV
SVAVATPTGLLTPIVKNADSKGLSTISKEVKELVKRAKINKLNPDEFQGGTICISNMGMN
DAISMFTSIINPPQSTILAIGTVERVPVEDVTTENGFSFDDTMNITGTFDHRTIDGAKAA
EFMKELKTVIENPLELLL
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcgatcttaagggccattccaaaaatctcgagatctagtggagtgatcgcatca
acaagatctcaaatcaataatcaactgagatatcaattgcatctaagagcaacctacgca
tcttcttcatatccgcctcatatgatcattggtatgcccgctttatcccctaccatggct
cagggtaatttggcagtttggactaaaaaggaaggggattcattatctcctggtgaagtt
attgccgaggtggaaactgataaagctcaaatggatttcgaattccaagatgaagggttt
ttagctaagattttggtcccagaaggtactaaagatatcccggtgaataaaccaattgcc
gtttatgtcgaggaggaaaatgatgttccagcatttaaagattttaaactggatgaggtg
actggcagtaccagtaatggcagtaatgataacactgcaaagcaacaaaaggaggatgga
aacgaagcatccaaaaaacttgaagacaaatctgaagaaaaaccaaaatcaaaaccaaaa
tcaaagaaaacaacggctacaactgacaaagatgccactgttaatacttcaagaattatt
gcttctccattggctaagacaattgccttggaaaatggtatcgctttgaaaaacatgaag
ggatctggcccacatggtagaatcgttaaggcagacgtaatggaatttttggaaaagaat
aaaaatgcaccatcatcatcaaccagcagtggtggacctacattatccgtatcaagtact
gctacctctacctcatatgaagatatggaaatttcaaacatgaggaaaattatcggtgat
cgtttattacaatcaacacaaagtatcccatcttatatcatttcatccaaaatatctgtt
tctaaattattaaaattgagaaaatcattgaattccactgcaaatgataagtataaatta
tcaataaatgatatcttaattaaagccattacagtggcagccaagagagttcccgatgct
aatgcatattggatgcccgatggtaaaaatataatcagaaggtttaagaatgtagatgtt
tcagttgctgtggctacaccaacaggtttattgacaccaatagtgaaaaatgcggattca
aaagggttaagtactatttctaaagaagttaaagagttagtcaaacgcgccaagataaat
aaattgaatccagatgagttccaaggtggtaccatttgtatctccaatatgggtatgaac
gatgcaatttccatgttcacatctattattaatccaccacaatcaaccattttggctatc
ggtactgtggaacgggtccctgtagaagatgtaaccactgaaaatgggttttcattcgat
gatacgatgaatattacaggtacatttgatcatagaactattgatggagctaaagcagca
gaattcatgaaagaattaaagactgtcattgaaaacccattagaattgttgctatga

DBGET integrated database retrieval system