KEGG   Naumovozyma dairenensis: NDAI_0F02780Help
Entry
NDAI_0F02780      CDS       T02234                                 

Gene name
NDAI0F02780
Definition
hypothetical protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ndi  Naumovozyma dairenensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:ndi01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ndi00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ndi00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:complement(682561..684231)
Genome map
AA seq 556 aa AA seqDB search
MVKKNLENVELLVDINNTPNFPPSQTTDATILTKEALEFIVLLHRTFNERRKTLLNNRVA
FQNKLETGKIQLDFLPETVSIRNDPTWLGPSLAPGLINRSCEITGPPLRNMLINALNSDV
NTYMTDFEDSISPTWTNLIGGQINLYDVLRNQIDFTSIKGKSYKLNKKVQDSPTIIVRPR
GWHMTENHLLVDNEPISASIFDFGLYFFHNAEKSVQLGKGPYFYLPKMEHHLEAKLWNDI
FNVAQDYIGMSRGTIRATVLIETLPASFQMEEIIWQLRQHSSGLNCGRWDYIFSTIKKFK
NDPNHILPDRDQVTMTSPFMDAYVKRLINTCHRRNVHAMGGMAAQIPIKNDPVKNDAAMN
KVKTDKIRELTNGHDGSWIAHPALAQICNDVFINMGTPNQIHFVPSEGTKVTAQDLTNTN
IINAKVSIEGIKQNLDIGLQYMEAWLRGSGCVPINSLMEDAATAEVSRCQLYQWVTHSVM
TSDGIKVTPQLTSKLLKEQVDKLKQVSPVGNQNKFDLAAKYLLPEITGEKFSDFLTTLLY
DEIVTPKQRPFDLSKL
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggtcaagaaaaatttagaaaatgtcgaattgttagttgacattaacaatactccaaat
ttcccaccatctcaaactacagacgctacaatcttaacgaaggaagccctagaattcatc
gtcctattacatagaacattcaatgaaagacgtaaaacattactaaataacagagttgca
ttccaaaacaaattagaaaccggtaaaattcaattggatttcctaccagaaacagtttca
attcggaacgatccaacatggttaggtccttctttagctccaggtttgatcaacagatca
tgtgaaatcacaggtccaccgttaagaaacatgttaattaacgctctaaattcagacgtt
aacacttacatgactgattttgaagattccatctcaccaacttggacaaatttaatcggt
ggtcaaattaatttatacgatgtattaagaaaccaaatcgatttcacttcaattaagggt
aaatcatacaaattaaataaaaaagtacaagattctccaactattatagtaagaccacgt
ggttggcatatgactgaaaaccatctattagttgataatgaaccaatttctgcatccatt
ttcgatttcggtctgtatttcttccataacgctgaaaaatctgttcaattaggtaaaggt
ccttatttctatttacccaaaatggaacatcatttagaggcaaaattatggaatgatata
tttaacgtggctcaagattatataggaatgtcaagagggactattagagctaccgttttg
attgaaactttaccagcttctttccaaatggaggaaattatttggcaattacgtcaacat
tcttcaggtttgaattgtggtcgttgggattatatcttttccacaattaagaaatttaaa
aatgatccaaatcatatattacctgatagagatcaagtgactatgacttctccattcatg
gatgcatacgtgaaaagattaattaatacatgtcatcgtagaaacgttcatgctatgggt
gggatggctgctcaaatcccaattaaaaatgatcctgttaaaaatgatgcagctatgaat
aaggtaaagactgataagattagagaattgactaatggtcatgatggttcttggattgcc
catcctgctttggctcaaatctgtaatgatgttttcattaatatggggactccaaatcaa
attcattttgtaccatcagaggggactaaagttaccgcacaagatttaactaatacaaat
attataaatgcgaaagttagtattgaaggtattaaacaaaatttggatatcggtttacaa
tatatggaagcttggttaagaggttctggttgtgttccaattaatagtttaatggaagat
gccgccacggcagaagtatcacgttgtcaattataccaatgggttactcattctgtaatg
acatctgatggtattaaagtgactccacaattaacttcgaaattattgaaagaacaagtt
gataaactgaaacaagttagtcctgtgggtaatcaaaataaattcgatttggctgcgaag
tatttattaccagaaattactggagaaaaatttagtgatttcttgactactttattatat
gatgaaatcgttactccaaagcaaaggccttttgacttgagtaaattataa

DBGET integrated database retrieval system