KEGG   Naumovozyma dairenensis: NDAI_0G00460Help
Entry
NDAI_0G00460      CDS       T02234                                 

Gene name
NDAI0G00460
Definition
hypothetical protein
Orthology
K18443  
golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1
Organism
ndi  Naumovozyma dairenensis
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    NDAI_0G00460 (NDAI0G00460)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:96075..100646
Genome map
AA seq 1523 aa AA seqDB search
MDSKELMTAVDPVTIVIKECINLSTAIRKYSKIASQSSGVAALLGGGSEIFSNQDASLAH
TFNNLSANKHNDPFLSGFIQLRLMLNKLNSLDGIDSLTLLQPFLLTISTSSISGYITSLA
LDSLQKFFTLNVINFDSLNYIGAYREVANALTHCRFEGSEQLSDDSVLLKVVLLLQDLIN
SPYGELLTDSTMYDIVQTIMSLACNKRRTEVLRKAAESTMTIITLKIFSSLKTMEPLDST
EKYINDEGYSKNTLKDDVIVISNQESEQPTMQIVPSIVDDKSVASNDAESVLSSNEDEVG
TNLEIEKQPFELQNTEQEAIATQNEDTDGENETNKLKVEIKEKDLTISSGTYGLPLAKQY
LSLLLSLIIPENQAKHTNSTRIFALQLINTIIEIVGDKFPLYPPLFTLISDPIFKCIFYI
IQNTNKLSLLQGALQLFTSLVLILGNHLPMQIELTLTRIFSMLLDDTTEANNPTMTPNNA
SSTSINTANEYQPKSPAIKELLIEQISILWTRSPSFFTSMFINFDCNLERSDVSVNIIKA
LTKLSLPEAAISTTDSVPPICLEGLISLVDDMFDHMQDVDRNEYMKQFNGKINEILKQRE
RKTEFIKSAELFNENPKLGIPSLIEKGFIKSNSDEDIAEFLFENNSRMNKRTIGLLLCNP
KRTPLLKCFIDLFDFKGLRVDEAIRILLTKFRLPGESQQIERIIEAFSTKYVDNQDYKPI
ETGNDLEEEADLGSSPTDNAESRVEGDTEESEQIEDISTVQPDSDSVFVLSYSIIMLNTD
LHNPQVKEHMSFNDYSGNLRGCCNEKDFPHWYLDKIYCSIRDKEIVMPEEHHGNEQWFED
AWNNLISSTTVLTEIQRDSTNIIDKLSSLELLLFDRAIFKHVGNAIVSTLFKIYKVASDD
HISSRMLTTLDKCSFIASFFNFKTLYNDILRHIARFTTLLKIKPSNKKNANAASVANDDV
DDIPLVEVTIEGQEKKVPVSSEIIRLGRSFKGQLCTVVLFRILQRNIDSEIIIPELWNDI
VKILLTLYENLLISPDIFSDLQSNLKIGKLPKPSSQAAIMKSNENKGLLSTFASYLKGDE
EPTDEEIHYSRRAMTCIESSHVAAALFGNEKNITPGLIQSLLNSIKLERNNENDKFFEAE
TLFLLELSVAMLVFCKNGGSLGNETLEKIITFSQLPGSKKGTHRRLLTYKILLISLLDQQ
PDNLLKVINDELVTKRDLYTDKYFISDTGTEVIRRLLELTNVDNYKSVMLEDEGFWKLLR
MNASIKEHTEMIFDYLAKSLAKDGCFMTSTNFMLILGLLDEISSVGSVGARWEQEYKMSI
QSGHQVDNKNPYQALVRISLRSIDLTSQLIENSKKFELGKTEIFTICQALAHQCSNPCQE
ISSHAIVTLTSFLTEKVSLPRVELTNMEELIEGGLLPVLKTHEESKSDNANILLGNILDV
ISKTYIYYLKDGITTNETFLEVLNIFNRYVEIPEIEKQLQQLIIEKKDIEKQARESSTTP
SVVDEAAAADDNIPVDAGAPGDA
NT seq 4572 nt NT seq  +upstreamnt  +downstreamnt
atggattccaaagaattaatgacagcagttgatcctgttaccattgtcatcaaagaatgt
atcaatttatctaccgcaataaggaaatattcgaaaattgcatcccaatcatctggtgta
gcagcattattaggcggtggaagtgaaattttcagcaatcaagacgcctccttagctcat
acatttaataacttatcagcgaacaaacataacgatccatttctctcaggattcattcaa
cttcgattaatgctaaataaattaaactcattagatggaatcgattcattgacactttta
caaccattcctattgacaattagtacaagttcgatctccgggtatatcacttcattagcg
ttggattcgttacaaaagtttttcactttgaatgtaataaattttgattcattaaactat
atcggtgcatatagagaagtagcgaatgcattaactcattgtaggtttgaaggttctgaa
caattatctgatgactcggtccttttaaaagttgtattattgttacaagatttaattaat
tcgccatatggagagctattgaccgactctaccatgtatgatatagtgcagaccattatg
tcattggcttgtaataagagaagaactgaagtgctaaggaaagctgctgaatcaacaatg
actataattactttaaagatattttcaagcttgaaaacaatggaaccactagactctact
gaaaaatatattaatgatgaagggtatagtaagaacactttgaaagatgatgtcattgtc
atatcaaatcaagagtcagaacaaccaacaatgcagatcgttccctctatagtagatgat
aaatctgttgcttccaatgacgctgaatctgttctctcttctaatgaagatgaggtaggt
actaaccttgaaatagagaagcaaccttttgaattgcaaaacacggaacaagaagctatt
gctactcaaaatgaagataccgatggcgaaaacgaaacgaataaattgaaagttgaaata
aaagagaaagacctaacaatatccagtggtacatatggtttacccttggcaaagcaatac
ctatctcttctactttccctaataattcctgaaaaccaagcaaaacacacaaattctaca
agaatatttgcactacaactaattaatactattatcgaaattgtaggagacaagttccca
ttatatcctcctttattcactttaatatcagatccaattttcaaatgtattttttatatt
attcaaaacacaaacaaactatcactattacaaggcgctttacaattattcaccagttta
gttctcatcttaggtaaccatctacccatgcaaattgagttgacactaacgagaattttc
tccatgttacttgatgataccactgaggctaacaacccaacaatgacaccaaataatgca
agttcaacttctattaacacggcaaatgaatatcaaccaaaatcaccagcaataaaggaa
ttactaattgaacaaatttcaattctttggactagatctccatctttcttcacatcaatg
tttattaatttcgattgtaatttggaaagatcagacgtttctgtaaacattattaaggca
ttaactaaattatcattacctgaagctgctatcagtaccacagatagtgtacccccaatc
tgtctcgaaggtttaatttcattagttgatgatatgtttgatcacatgcaagacgtagac
aggaatgaatatatgaaacaattcaatgggaaaataaatgaaatcctaaaacaaagagaa
cgtaagactgaatttattaaatctgctgaattatttaatgaaaatccaaaattaggtatc
ccatcattaatcgagaaggggtttatcaaatcaaactctgatgaagatatcgcggaattc
ctttttgaaaataatagtagaatgaataagagaactattggtttgttactttgtaatccg
aaaagaacccctcttttgaaatgttttattgatttattcgattttaaaggtttaagagta
gatgaagctattagaatattattgactaaatttagattaccaggtgaatctcaacagatt
gaaagaattattgaagcattctctactaaatatgttgataatcaagattataaaccaatt
gaaacaggcaacgatttagaagaagaggctgatcttggaagttcgccaactgataatgct
gagagtagagtagagggagacacagaagaatcggaacagattgaagacatttccactgtt
caacctgattctgattcagtcttcgttttaagttattctatcatcatgttgaataccgat
ttgcataatcctcaagttaaagaacatatgtcattcaacgattattctggtaatttgaga
ggatgttgtaatgaaaaggatttcccgcattggtatctggacaagatatattgctctata
agagataaagaaattgtaatgcccgaagaacatcatgggaatgaacaatggtttgaagac
gcttggaataacttgatttcatcaaccactgtcttgactgagatacaaagagattcaact
aatattatcgataaactctcatcattggaactattacttttcgatagagcaattttcaaa
catgttggtaatgccattgttagtacattattcaaaatttataaagtggcttctgatgat
catatttcaagtagaatgttaactactttagataagtgttcatttattgcatcgtttttc
aattttaaaacattgtataatgatattcttcgtcatattgcccgtttcacaacattattg
aaaataaaaccatctaataagaaaaatgcaaatgcggcaagcgtagcaaatgatgatgtt
gacgatataccattagttgaagtaacgatagaaggtcaagaaaagaaagtccctgttagc
agtgaaataatccgcttgggaagatcatttaagggtcaactttgtaccgtagttttattc
agaatattacaaagaaatatagattcagaaattataatacctgaattatggaatgatatt
gttaagattctgttaactctttatgaaaatttattaatatcacctgatattttttcagat
ttacaatctaatttgaaaattgggaaattacctaaaccatcatctcaagcggctattatg
aaaagtaatgaaaacaagggattactttcaacatttgcttcttatttgaaaggtgatgag
gaacctactgacgaagaaatccattattcaagaagggctatgacatgtattgaatctagt
cacgttgcagcagcactttttgggaatgaaaaaaatattacacctggcttaattcaatct
ttattgaattcaattaaattggaaaggaacaatgaaaatgataaatttttcgaagcagaa
acattattcttacttgaattatcagtcgccatgcttgttttttgtaagaatggcggatct
ctgggtaatgaaacattagaaaaaattattaccttttcacaattacctggatctaaaaag
ggaacccatcgtaggttattaacttataaaatattattgatttcattgttagatcaacaa
ccagataatttattaaaagtgattaatgatgaattagtaacgaaacgggatctctacacg
gataaatattttattagtgataccggtacggaggtgataagaagattacttgaattaaca
aacgtggataattataaatcggtcatgttggaagatgaaggattttggaaattactaaga
atgaatgcatccataaaggaacatactgaaatgatatttgattatttagcaaaatcgctt
gcgaaagatggttgctttatgacgtctacgaatttcatgttgattttaggattattggat
gaaatatcatcagttggctctgttggtgctcgttgggaacaagaatataaaatgtcaatc
caaagtggacatcaggtcgataataaaaatccatatcaagcattggtcagaatatcgcta
agatccattgatttgacgtcacaattaatagagaactctaaaaaatttgaacttgggaag
accgaaatatttacaatatgtcaagccttggcacatcaatgtagtaatccatgccaagaa
attagttcgcacgctattgtaacactaacgtcatttttaacagaaaaagtttcattgcca
agggttgaacttacgaatatggaagaattaattgaaggtgggttacttcctgttttgaag
acacatgaagaaagtaaatctgataatgctaatattctattagggaatattcttgatgtt
atttctaagacttacatttattatctgaaggatggtatcacaacgaatgaaacgtttttg
gaagtattaaacatatttaataggtatgttgaaatacccgagattgaaaaacaattacaa
caacttatcattgagaagaaagatattgaaaagcaagcaagagagtccagcacaacacct
tccgttgtcgatgaagctgctgctgctgatgataatataccggtcgatgcgggagcgcca
ggtgatgcctga

DBGET integrated database retrieval system