KEGG   Naumovozyma dairenensis: NDAI_0G00620Help
Entry
NDAI_0G00620      CDS       T02234                                 

Gene name
NDAI0G00620
Definition
hypothetical protein
Orthology
K15198  
transcription factor TFIIIB component B''
Organism
ndi  Naumovozyma dairenensis
Brite
Transcription machinery [BR:ndi03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIB
     NDAI_0G00620 (NDAI0G00620)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:complement(134586..136523)
Genome map
AA seq 645 aa AA seqDB search
MSSVVNKSGTRFAPKARQRRAGTSTPTPVPLPMPVQKPIITNDEALHNQEVEGEDEIPAK
NSDHDNNAEPPSPKAKTVVEETSTYNKLTTKVNTFAMHLQNGDSISPSQTSTQLNQQDDA
IPIPKSAVINPPTTVRSGRLASLSKTINAPLFKTDYTANTTVTDGKKERRLSTISTSLPK
KIKMANAMVTENDNATLNALKRRRMSSRSSVSKKTGSQRRISVVSKINVPVGKSTSSSSS
ASSSKATSRATSINSSLNGVYTATPIPNPARIKVGEEEEFFQKTDALYGKYIIKNFKEIP
KNIRDDDSKRYMIDEEKFTIAELCKPNLPIGEISENFEKSKMANKLKLTKRKYKREMRKR
AREEFRSLRSLNKEEEEEERENRKQAAEKLLNTDVPDSYKPHTAIQLKLNPDGTLAVDEE
STVVDRHKNASLENAHKQKVDENPFEKLYNSATYGRNSFTDPWTTEEIIKFYKALSMWGT
DFNLIAQLFPYRTRRQIKSKFINEEKKHPIMIELALRSRLPPNFDQYCADIRRELGTVSD
FNKKLEDLQLEHQENLKQIQLAKDNAKMEDSTLVKEDASNTNKKGPGGFMSNDLKVYRKT
EVVLGTIDDIKRKREEEEDEGDNDSDADKHEVGHHHRINKIEMAK
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtgttgttaataaaagtggaactcgttttgccccaaaggcaaggcaacggaga
gctggtacttccactcctactccagtaccattgcctatgcctgtccagaaaccaattatt
accaatgatgaagcattacataaccaagaagttgaaggtgaggatgagattccggccaaa
aatagcgatcatgataataatgctgaaccgccttcaccaaaggcaaaaactgtagttgaa
gaaacttccacatataataagcttactactaaagttaatacattcgccatgcatttgcaa
aatggtgattctatctcgccttctcaaacgagcacacaacttaatcaacaagatgatgca
attccaataccgaaatcagcagtaatcaacccaccaacaaccgtaagatcaggaagatta
gcatcattaagtaagaccataaatgcaccattatttaaaaccgattatacagctaatact
actgtcacagatggtaaaaaggaaagaagactatccacaatctctacatctttaccgaag
aaaattaaaatggccaatgcgatggttacagaaaatgataatgctacattgaatgcccta
aagagacgccggatgtcaagtagatcatctgtctctaagaagacaggctcgcaacgtaga
attagtgtcgtttccaaaataaacgtccctgtgggtaaatcaacttcttcgtcttcttca
gcatcatcatctaaagccacatctagagcaacttctattaattcttcactgaatggagtt
tatacagcgacaccaattccaaatccagcaagaattaaagttggtgaagaggaagaattt
ttccaaaagacagatgccttgtatggaaaatatattattaagaatttcaaagaaatccca
aagaatattcgagacgatgattcaaaacgttatatgattgatgaagaaaagttcaccatt
gcagaattatgtaagccaaatttgcccattggtgaaatttctgaaaattttgaaaaatca
aaaatggcaaataaattgaaattaaccaaaaggaaatataagagagagatgaggaagcgt
gctcgtgaagaatttagatcattacgttcattaaataaagaagaagaagaggaagagagg
gaaaatcgtaaacaagctgcagaaaaattattgaatactgatgttcctgatagttataaa
ccccatactgcaattcaattgaaattaaatcctgatggtactttagccgtcgatgaagaa
tccacagtggtggatagacataagaatgcaagtttagaaaatgcacataaacaaaaagtc
gatgagaatccatttgaaaaattatataattcagctacatatggtaggaattcttttact
gatccatggactacagaggaaatcattaaattttataaagctttatccatgtgggggacg
gattttaatttaattgcacaattattcccatatagaacaagaagacaaattaaatctaaa
tttattaatgaagaaaagaaacacccaattatgattgaattagcacttcgatcaagatta
ccaccaaatttcgatcaatattgtgctgatattagaagagaattaggtaccgtttctgat
ttcaataagaaattagaagatttacaattagaacatcaagaaaatttgaaacaaattcaa
ttagctaaggataatgccaagatggaagattcaactttggttaaagaggacgcatccaat
actaacaaaaagggtcctggtgggtttatgtctaatgatttgaaagtatatagaaagaca
gaagttgttcttggtaccattgatgatataaagaggaaaagagaagaggaagaagatgaa
ggcgacaatgatagcgacgcagataaacacgaagtaggtcatcatcacagaataaataaa
atagagatggcaaaataa

DBGET integrated database retrieval system