KEGG   Naumovozyma dairenensis: NDAI_0G00620Help
Entry
NDAI_0G00620      CDS       T02234                                 

Gene name
NDAI0G00620
Definition
hypothetical protein
Orthology
K15198  
transcription factor TFIIIB component B''
Organism
ndi  Naumovozyma dairenensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:complement(134586..136523)
Genome map
AA seq 645 aa AA seqDB search
MSSVVNKSGTRFAPKARQRRAGTSTPTPVPLPMPVQKPIITNDEALHNQEVEGEDEIPAK
NSDHDNNAEPPSPKAKTVVEETSTYNKLTTKVNTFAMHLQNGDSISPSQTSTQLNQQDDA
IPIPKSAVINPPTTVRSGRLASLSKTINAPLFKTDYTANTTVTDGKKERRLSTISTSLPK
KIKMANAMVTENDNATLNALKRRRMSSRSSVSKKTGSQRRISVVSKINVPVGKSTSSSSS
ASSSKATSRATSINSSLNGVYTATPIPNPARIKVGEEEEFFQKTDALYGKYIIKNFKEIP
KNIRDDDSKRYMIDEEKFTIAELCKPNLPIGEISENFEKSKMANKLKLTKRKYKREMRKR
AREEFRSLRSLNKEEEEEERENRKQAAEKLLNTDVPDSYKPHTAIQLKLNPDGTLAVDEE
STVVDRHKNASLENAHKQKVDENPFEKLYNSATYGRNSFTDPWTTEEIIKFYKALSMWGT
DFNLIAQLFPYRTRRQIKSKFINEEKKHPIMIELALRSRLPPNFDQYCADIRRELGTVSD
FNKKLEDLQLEHQENLKQIQLAKDNAKMEDSTLVKEDASNTNKKGPGGFMSNDLKVYRKT
EVVLGTIDDIKRKREEEEDEGDNDSDADKHEVGHHHRINKIEMAK
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtgttgttaataaaagtggaactcgttttgccccaaaggcaaggcaacggaga
gctggtacttccactcctactccagtaccattgcctatgcctgtccagaaaccaattatt
accaatgatgaagcattacataaccaagaagttgaaggtgaggatgagattccggccaaa
aatagcgatcatgataataatgctgaaccgccttcaccaaaggcaaaaactgtagttgaa
gaaacttccacatataataagcttactactaaagttaatacattcgccatgcatttgcaa
aatggtgattctatctcgccttctcaaacgagcacacaacttaatcaacaagatgatgca
attccaataccgaaatcagcagtaatcaacccaccaacaaccgtaagatcaggaagatta
gcatcattaagtaagaccataaatgcaccattatttaaaaccgattatacagctaatact
actgtcacagatggtaaaaaggaaagaagactatccacaatctctacatctttaccgaag
aaaattaaaatggccaatgcgatggttacagaaaatgataatgctacattgaatgcccta
aagagacgccggatgtcaagtagatcatctgtctctaagaagacaggctcgcaacgtaga
attagtgtcgtttccaaaataaacgtccctgtgggtaaatcaacttcttcgtcttcttca
gcatcatcatctaaagccacatctagagcaacttctattaattcttcactgaatggagtt
tatacagcgacaccaattccaaatccagcaagaattaaagttggtgaagaggaagaattt
ttccaaaagacagatgccttgtatggaaaatatattattaagaatttcaaagaaatccca
aagaatattcgagacgatgattcaaaacgttatatgattgatgaagaaaagttcaccatt
gcagaattatgtaagccaaatttgcccattggtgaaatttctgaaaattttgaaaaatca
aaaatggcaaataaattgaaattaaccaaaaggaaatataagagagagatgaggaagcgt
gctcgtgaagaatttagatcattacgttcattaaataaagaagaagaagaggaagagagg
gaaaatcgtaaacaagctgcagaaaaattattgaatactgatgttcctgatagttataaa
ccccatactgcaattcaattgaaattaaatcctgatggtactttagccgtcgatgaagaa
tccacagtggtggatagacataagaatgcaagtttagaaaatgcacataaacaaaaagtc
gatgagaatccatttgaaaaattatataattcagctacatatggtaggaattcttttact
gatccatggactacagaggaaatcattaaattttataaagctttatccatgtgggggacg
gattttaatttaattgcacaattattcccatatagaacaagaagacaaattaaatctaaa
tttattaatgaagaaaagaaacacccaattatgattgaattagcacttcgatcaagatta
ccaccaaatttcgatcaatattgtgctgatattagaagagaattaggtaccgtttctgat
ttcaataagaaattagaagatttacaattagaacatcaagaaaatttgaaacaaattcaa
ttagctaaggataatgccaagatggaagattcaactttggttaaagaggacgcatccaat
actaacaaaaagggtcctggtgggtttatgtctaatgatttgaaagtatatagaaagaca
gaagttgttcttggtaccattgatgatataaagaggaaaagagaagaggaagaagatgaa
ggcgacaatgatagcgacgcagataaacacgaagtaggtcatcatcacagaataaataaa
atagagatggcaaaataa

DBGET integrated database retrieval system