KEGG   Naumovozyma dairenensis: NDAI_0G01550Help
Entry
NDAI_0G01550      CDS       T02234                                 

Gene name
NDAI0G01550
Definition
(RefSeq) hypothetical protein
  KO
K11778  ditrans,polycis-polyprenyl diphosphate synthase [EC:2.5.1.87]
Organism
ndi  Naumovozyma dairenensis
Pathway
ndi00900  Terpenoid backbone biosynthesis
ndi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NDAI_0G01550 (NDAI0G01550)
Enzymes [BR:ndi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.87  ditrans,polycis-polyprenyl diphosphate synthase [(2E,6E)-farnesyl diphosphate specific]
     NDAI_0G01550 (NDAI0G01550)
Prenyltransferases [BR:ndi01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   NDAI_0G01550 (NDAI0G01550)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Prenyltransf
Motif
Other DBs
NCBI-GeneID: 11497327
NCBI-ProteinID: XP_003671174
UniProt: G0WDS0
Position
7:complement(341271..342143)
Genome map
AA seq 290 aa AA seqDB search
MEGIESSSNIPGYNITLKWVKNIFSRSLRVSNNVPKHVGFIMDGNRRYARKNGIEVKEGH
ETGFFTMSKILELCYESGVTCATVYAFSIENFKRSPYEVDALMNLARLRIKQIVDKGEMA
EKYGIKVKIIGDTSLLDADLIKDIQNAMEITKNNNRAILNICFPYTGREEIYHSMKECMA
KYCDNGEPEFKINESSLDLNLYTGGEPPLDLLIRTSGVARLSDFMLWQISNKGVVIELID
CLWPDFGPLRMAWILLKFAFQKSFSNRTKKFEEEDIDLDEDYANGSKKDI
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggagggtatagaaagtagtagtaatattccaggttacaacataacattaaaatgggta
aaaaatatattttcacgatcattaagagtttctaataacgttcccaagcacgtggggttt
attatggatggtaatagacgatatgccaggaaaaatgggatagaagtgaaagaaggtcat
gaaactggatttttcacaatgagtaaaattctagaactttgttatgaatcaggtgttaca
tgtgctactgtttatgcattttccattgaaaattttaagagatctccttacgaagtggat
gctttgatgaatttggcaagattaagaattaaacaaattgtagataaaggtgaaatggct
gaaaaatatggtataaaagtgaaaattattggtgatactagtttattagatgctgatctt
ataaaggatatacagaatgcaatggaaattactaaaaataataatagagccatattaaat
atttgttttccatataccggtagagaagaaatttatcattcaatgaaagaatgcatggcg
aaatactgtgataatggagaaccagaattcaaaatcaatgaatcctcccttgatttaaat
ctttatacgggcggtgaaccgccattagacttactgattagaacaagtggtgtagcaaga
ttaagtgatttcatgctttggcagataagtaataaaggtgtggtgatagaactgatagat
tgtttatggccagattttggtcctttaaggatggcatggatacttttgaaatttgcgttc
cagaaatctttttcaaatagaactaaaaagtttgaagaagaagatatagacttagatgaa
gattacgctaatggatccaaaaaagacatatag

DBGET integrated database retrieval system