KEGG   Naumovozyma dairenensis: NDAI_0G01640Help
Entry
NDAI_0G01640      CDS       T02234                                 

Gene name
NDAI0G01640
Definition
(RefSeq) hypothetical protein
Organism
ndi  Naumovozyma dairenensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RCR TMEM154 Colicin_V DUF4064 TMEM51 DUF3382
Motif
Other DBs
NCBI-GeneID: 11497336
NCBI-ProteinID: XP_003671183
UniProt: G0WDS9
Position
7:complement(361497..362402)
Genome map
AA seq 301 aa AA seqDB search
MEQQQQQQQGKIGTGAALLAGVVGGFILGSNDDDDGDRTTITTTRTYATTATQGTRTTIY
TATSTSKVISQSYTDPEDSGEFGKWFGVAIAGIVGAVLLIIIVFSIINSIRNRRKERPIT
GTSWIPTYNVPSTDTTFKNCRDEEDFVPQYTERVNMNDLGYYDERGDFHRNEDVRTYDGN
KNSQIPPPAFFPIADPAFPSSRSSLPFSNFARPSGSPPGVPKINLPEEELQEEEGEEKIQ
GYAETGSQVEHLSAVPSNSPKYEIGKVKTVTTSTLTTTSTNNGINDDGESFVDVKSSRSE
V
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggaacaacaacaacaacaacaacaaggaaaaatcggcaccggtgctgcacttttagct
ggggtcgtcggtgggttcatcctaggtagcaatgatgatgatgacggtgatcgcactaca
attaccactactaggacatatgctactactgctactcagggaacacgtaccaccatatat
actgcaacatctacatcaaaagttatttcccaatcttatacggaccctgaagatagtgga
gagttcggtaaatggtttggtgttgcaattgcaggaattgtaggtgcagtattattaatt
atcattgttttttcaattattaattccataagaaatagaaggaaagaacgccccattaca
ggaacatcatggattcctacctataatgtaccatcaacagacactacttttaaaaattgt
cgtgatgaagaggattttgtccctcaatatactgaaagggttaatatgaatgatttaggt
tattatgatgaaaggggcgacttccatcgtaatgaagatgtaagaacatatgatggtaat
aaaaattcgcaaataccacctccagctttttttcccattgctgatcctgcttttccctct
tccagatcatcattacctttttcgaattttgctcgtccttcaggttcaccgccaggagta
ccaaagatcaatctaccagaagaagagctacaagaagaagaaggtgaggaaaagatacag
ggatacgctgaaactggttcacaagttgaacatttatccgctgtacctagtaatagccct
aaatatgagatagggaaggtgaaaacggtaacaacaagtacgctgacgacgacctccact
aataacggcatcaatgacgatggtgaatcgtttgttgatgtgaaatcatcaagatcagag
gtataa

DBGET integrated database retrieval system