KEGG   Naumovozyma dairenensis: NDAI_0G02540Help
Entry
NDAI_0G02540      CDS       T02234                                 

Gene name
NDAI0G02540
Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
ndi  Naumovozyma dairenensis
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ndi00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:complement(581052..582866)
Genome map
AA seq 604 aa AA seqDB search
MPTSSYRHSRSHSRSSSSSRRPSLSRQRSSHRLIRTISVESLELHKDQNNTSALTTGTTT
TTTTTSIETTTTTTTTTTKHDIDGEELNLDSKLDTLNLNNNECIEVPFIKATIDNTLPQD
YLKDDILNMIQSLKIPKWHQRGHFVSSPLKRDSLILTKITGAMTNAIYKVEYPSLPSLLL
RVYGSNNDTIIDRDYELQVLARLSIRNIGPSLFGCFSNGRFEQFLENATTLNKDDIRDWK
TSQRIARRMKELHIGVPLLSSEREKGPVCWQKINQWVKFLDTNPKAQIWIKNDTNIQTHL
LCKNWKDFKTAISKYQNWLSSFHSDAKGKNLGFCHNDAQYGNLLFSAPIKPTTNDINIDS
NTPTATTSTSEPPTLSTATSSSSLFPSNSRIQIDEIIKPTKQEQSQDSKLVVIDFEYSGA
NPVAYDLANHFSEWMYDYNNASAPHVAHVESYPNREQILNFIYSYVSHLRGGAREPIDEE
VKVLYNSILRWRGVCQLFWSIWAVLQSKDLKLMLETENETFEGPNGEQYIVKVEKDNNND
NEMIERIDSIDDESVGVDIDSFDYMAYCQDKISIFWGDLIKFNVVNEFECYSLDSARYLD
SEEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgcccacttcatcatatcgccattcaagatctcattctaggtcttcaagttcttctaga
agaccatctttaagtcgtcagagatcttcacatagattaatccgtacaattagcgttgag
tccctcgagctccataaggaccaaaataatacttcagctttgacaactggtactactaca
accaccaccactactagcattgaaacgacaacaacaacaacaactacaacaacaaaacat
gacattgatggtgaagagttgaatttagattcaaaacttgacacattgaaccttaataac
aatgaatgcatcgaggttccctttatcaaggcgacaatcgataacaccctccctcaagat
tatttaaaggatgatatccttaatatgatccaatcattaaaaattccaaaatggcaccaa
agaggtcattttgtttcatcccctttaaaacgagattcattgattttaacgaagattact
ggtgccatgacaaacgcaatttataaagtggaatatccatcattaccgtccttactatta
agagtttacggttctaataatgacacgatcattgatagagattacgagttacaagttttg
gcaagattatctatacgtaacattgggccttcattatttggttgtttttctaatggtaga
tttgaacaattcttagaaaatgcaactactttgaataaagatgatattagggattggaaa
acttctcaaagaattgcaagaagaatgaaagagttacatattggtgtgcctcttttaagt
tctgaaagggagaaaggacccgtttgttggcaaaagattaatcaatgggtaaagttccta
gacacgaatccaaaagcacaaatttggattaagaatgatactaatattcaaacccatttg
ctttgcaaaaattggaaagattttaaaactgccatatcgaaatatcaaaattggttatca
tcattccactcggatgcaaagggtaagaatttaggattttgtcataatgatgcacagtat
ggtaatttattgtttagtgcgccaattaaacccacaactaatgatattaatattgatagc
aatacccctactgctactactagtacatcggaaccaccgacgctatcaacagcaacgtca
tcatcatcgttatttccttccaattctaggattcaaattgatgaaattatcaaaccaaca
aaacaagaacaaagtcaagattccaaactagtagtcattgatttcgaatattctggtgcc
aatccagttgcctatgatttagctaatcattttagtgaatggatgtacgattataataat
gcatcagcaccgcatgtagcacatgtggaatcatacccaaatagggaacaaatattgaat
ttcatttattcctatgtttctcatttaagaggtggtgctagggaacctattgatgaagaa
gttaaagttctttataattctatattaagatggagaggcgtttgtcagttattttggtct
atttgggcagttttacaaagtaaagatttaaagttgatgcttgagactgaaaatgaaaca
tttgaaggtcctaatggtgaacaatatatagtcaaagtggagaaggataataataatgat
aacgagatgatagagaggattgatagtattgatgatgaaagtgtgggtgtggatattgat
agtttcgattatatggcatattgtcaagacaaaatttcaatattttggggtgatttaatt
aaatttaatgtagtgaacgaattcgaatgttattccctggactcagctagatatttagac
tctgaggagttatga

DBGET integrated database retrieval system