KEGG   Naumovozyma dairenensis: NDAI_0G03740Help
Entry
NDAI_0G03740      CDS       T02234                                 

Gene name
NDAI0G03740
Definition
(RefSeq) hypothetical protein
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
ndi  Naumovozyma dairenensis
Pathway
Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    NDAI_0G03740 (NDAI0G03740)
Enzymes [BR:ndi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     NDAI_0G03740 (NDAI0G03740)
Chromosome [BR:ndi03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     NDAI_0G03740 (NDAI0G03740)
   HDAC complexes
    Sin3A-HDAC complex
     NDAI_0G03740 (NDAI0G03740)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    NDAI_0G03740 (NDAI0G03740)
  Chromatin remodeling factors
   NuRD complex
    NDAI_0G03740 (NDAI0G03740)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
7:complement(900866..902167)
Genome map
AA seq 433 aa AA seqDB search
MVYENKPFDEIQVKPNDKKRVAYFYDADVGNYAYGSGHPMKPHRIRMTHSLIMNYGLYKK
MEIYRAKPATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESVKFNVGDDCPVFDGLYEYC
SISGGGSMEGAARLNRGKCDVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHPRV
LYIDIDVHHGDGVEEAFYSTDRVMTCSFHKYGEFFPGTGELRDVGVGKGKYYAVNVPLRD
GIDDATYRNVFEPVVKRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVNYVKS
FGIPMMVVGGGGYTMRNVARTWCFETGLLNNVVLDQELPYNDYYEYYGPDYKLDVRPSNM
FNVNSPEYLDKIMTSIFVNLENTKYAPSVQLNNVPKDPEDLGDQEEDTAEAKDTKGGSQY
ARDKEVERTDELY
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggtgtacgaaaacaaaccctttgatgaaatccaagtgaaacccaacgacaagaaacga
gtagcatatttctacgatgcagacgttggtaattatgcctacgggtctggtcatccgatg
aaacctcatagaataagaatgacacattctttgatcatgaattatgggttatataaaaag
atggaaatttatagagctaaaccagctacgaagcaggaaatgtgtcaattccatactgat
gaatatattgattttttatctagagttacgcctgataatttggaattgtttaagaaggaa
agtgtgaagttcaatgtcggagatgattgtcctgtctttgatggattgtatgaatattgt
agtatctcaggtggtggatccatggagggagctgctagattgaatagaggcaaatgtgat
gtggccattaattatgccggtgggttacatcatgcaaagaaatctgaagcttcagggttt
tgttatttgaatgatattgttttggggatcattgaattattaaggtatcatccaagagtt
ctttatattgatattgatgttcatcatggagatggtgttgaagaagcattttattccaca
gatcgtgtcatgacttgttcattccataaatatggggaattcttccccggtacgggggaa
ttaagagacgtaggtgtgggtaaggggaaatattatgctgtcaatgtgcccctaagagat
ggtattgatgatgcaacgtatagaaatgtgtttgaaccagtggtgaaaagaatcatggaa
tggtatcaaccatctgcggtggttttacaatgtggtggtgattctttatcgggtgatcgt
ctaggttgttttaatttatctatgcaaggtcacgccaattgtgtcaattatgttaaatcc
tttggaattcccatgatggttgttggtggaggtggttatacaatgagaaacgtggcaaga
acatggtgttttgaaacaggattgttgaacaatgtggtgcttgatcaagaattaccatat
aatgactattacgaatattatggacccgattataaattggatgttagaccatctaacatg
tttaacgttaactctccggaatatctagataagataatgacgtctatttttgtgaattta
gaaaataccaaatatgcaccaagtgtccaattaaataatgtacccaaggatccagaagat
ttgggggatcaagaagaagatacagcggaagccaaggatacgaaaggtggttctcaatat
gcaagagacaaggaagtagaaagaactgatgagttgtattag

DBGET integrated database retrieval system