KEGG   Naumovozyma dairenensis: NDAI_0G03900Help
Entry
NDAI_0G03900      CDS       T02234                                 

Gene name
NDAI0G03900
Definition
hypothetical protein
Organism
ndi  Naumovozyma dairenensis
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:932670..933371
Genome map
AA seq 233 aa AA seqDB search
MEQNLNYKILERAKMAQLSRKIRVRLGKIQKGTVKNRKLEDKQMPAKNHPFWPLLCVVPP
VQPTTSASSGITSSPGYSMWDLMSRKGVGRNKYKSQGFSKKRILQEKESYNGRYKLPLDR
NYLSVPPDSREYNSDYWDHRPLSRSNNPVKAENGALEELKKMKFILKAPRRLEDLEYDPI
INSDDCNTSHYVSSMLMSEDTSNNKNSSPYFNDYVRDIYSVSSRGNISAGSPL
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggagcaaaatcttaattataagattctagaaagagcaaagatggctcaactctcccgc
aaaataagggttcgcctgggtaagatccagaaaggaaccgtgaagaatagaaaacttgaa
gataaacaaatgcccgccaaaaatcatccattttggccgctcctctgtgttgtacctcct
gtacaacccacgacatcggcttcatctggcattacaagctcgcctgggtattcgatgtgg
gatctcatgtctagaaaaggagttggaaggaataagtataaatctcaaggattttcaaag
aaaagaatattacaagagaaagaaagttataatggaagatataaattgccattagataga
aattatttatccgttcctcctgattcacgagaatataacagtgattactgggatcacaga
cccttgtcgaggagtaacaatccagttaaagcagaaaatggagctcttgaagagcttaaa
aaaatgaagtttatattaaaagctccccggaggctagaagatcttgaatacgacccaata
ataaactctgatgattgtaatacatcacattatgtttcctcgatgctgatgtcagaagac
acatccaataataagaattcctctccatactttaatgattatgtgcgtgatatttacagt
gtatcatccagaggaaacatatcagccggttctcccttgtga

DBGET integrated database retrieval system