KEGG   Naumovozyma dairenensis: NDAI_0G03920Help
Entry
NDAI_0G03920      CDS       T02234                                 

Gene name
NDAI0G03920
Definition
hypothetical protein
Orthology
K00924  
[EC:2.7.1.-]
Organism
ndi  Naumovozyma dairenensis
Brite
Enzymes [BR:ndi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.-  
     NDAI_0G03920 (NDAI0G03920)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:complement(934765..935889)
Genome map
AA seq 374 aa AA seqDB search
MSMDSGSNSVEKSNEFIADDVTSNRSNTVRRMLIQEYRKIGRGAFGTVVQAYITPNKENW
YGPFAIKKVPAQTEYKSRELEILRITNHPNVVKLEYFFTHVSPQDHKVYQHLAMECLPET
LQIEISRYAHNKLELALKHVKLYSYQIARGMLYLHALGICHRDIKPSNILVDPSTGVLKI
CDFGSAKRLEPNQPSISYICSRFYRAPELILGCTQYTTKVDIWGLGCVIGEMLMGKAIFQ
GQDPLLQLREIAKLLGPPDKKFIFFSNPGYDGPLYSKPLFSGTSKERFEKYFGHAGPDGI
DLLTKVLVYSPEIRLSPRRILNHSFFDDLLKEQYFFPRDSTQPVRLPNLFDFSEFELKIL
GEWGNKFTKQPEDH
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtctatggattctggaagtaattccgtcgaaaagagcaatgaattcatcgctgatgat
gtcacttcaaatagatccaatactgtaaggagaatgttaattcaagaatacaggaaaatt
ggtagaggtgcattcggtacagtagtgcaggcgtatattacaccaaataaagaaaattgg
tatggtccgtttgctattaaaaaagttcctgctcaaacagaatataaatcaagagaatta
gaaatccttagaatcacaaatcatccgaatgttgtcaaattggaatatttttttacacat
gtatctccacaagatcataaggtttatcaacatttagcaatggaatgtctaccagaaact
ttacaaattgaaattagccgatatgctcataataaattggaattagctttgaaacatgtt
aaactctatagttatcaaattgcaagagggatgttgtatttacatgcattgggaatttgt
catcgtgatataaaaccttcaaatatattagtagatccaagtacaggtgtcttaaagatt
tgtgattttggttctgctaaaagattggaaccaaatcaaccatcaattagttatatttgt
tcaagattttatagagctccagaattaatccttggatgtactcaatatacaacaaaagtt
gacatttgggggcttggatgtgtcatcggtgaaatgcttatggggaaagctatcttccaa
ggtcaagacccacttttacaattacgtgaaattgctaaattattaggacctccagataaa
aaattcatttttttctcaaatccaggttatgatggtccattatactcgaaacctttgttt
tctggaacatcaaaggaacgttttgaaaaatattttggtcatgctggtcctgatggaatt
gatttattaacgaaagtcttagtttattctccagaaataagactctctccaagacgtata
ctaaatcatagcttttttgatgatttgctaaaagaacaatatttcttcccaagagattcc
actcaacctgttcgtttaccaaatttatttgatttcagtgaatttgagttaaaaatattg
ggagaatggggtaataaattcacaaaacaacctgaagatcattaa

DBGET integrated database retrieval system