KEGG   Naumovozyma dairenensis: NDAI_0G03990Help
Entry
NDAI_0G03990      CDS       T02234                                 

Gene name
NDAI0G03990
Definition
hypothetical protein
Orthology
K02966  
small subunit ribosomal protein S19e
Organism
ndi  Naumovozyma dairenensis
Pathway
Ribosome
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    NDAI_0G03990 (NDAI0G03990)
Ribosome [BR:ndi03011]
 Ribosomal Proteins
  Eukaryotes
   Small subunit
    NDAI_0G03990 (NDAI0G03990)
  Archaea
    NDAI_0G03990 (NDAI0G03990)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:complement(join(950312..950726,951194..951213))
Genome map
AA seq 144 aa AA seqDB search
MPGVSVRDVAAQDFINAYASFLQRQGKLEVPGYVDIVKTSSGNEMPPQDSEGWFYKRAAS
VARHIYLRKQVGVGKLNKLYGGAKSRGVRPYKHIDASGSVNRKVLQALEKIGVVEISPKG
GRRISENGQRDLDRIAAQTLEEEE
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgccaggtgtttccgttagagacgttgctgctcaagatttcatcaacgcttatgcctct
ttcttgcaaagacaaggtaaattagaagttccaggttatgttgacattgtcaagacctca
tctggtaacgaaatgccaccacaagattccgaaggttggttctacaagcgtgctgcttct
gttgccagacacatctacttgagaaaacaagttggtgttggtaaattgaacaaattgtac
ggtggtgccaagagcagaggtgttagaccatacaagcacattgatgcttctggttccgtt
aacagaaaggttctacaagctttagaaaagattggtgttgttgaaatctctccaaagggt
ggtagaagaatctctgaaaatggacaaagagatttagatcgtatcgccgctcaaactttg
gaagaagaagaataa

DBGET integrated database retrieval system