KEGG   Naumovozyma dairenensis: NDAI_0G05290Help
Entry
NDAI_0G05290      CDS       T02234                                 

Gene name
NDAI0G05290
Definition
hypothetical protein
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
ndi  Naumovozyma dairenensis
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NDAI_0G05290 (NDAI0G05290)
Enzymes [BR:ndi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     NDAI_0G05290 (NDAI0G05290)
Glycosyltransferases [BR:ndi01003]
 Polysaccharide
  Storage polysaccharide
   NDAI_0G05290 (NDAI0G05290)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:1286686..1288812
Genome map
AA seq 708 aa AA seqDB search
MTRDLQNHLLFETATEVANRVGGIYSVLKSKAPITVAQYKDNYCLIGPLNKATYQNEVDQ
LDWESPETFPDELKPIQTALHAMRSRGVNFIYAKWLIEGSPRVILFDLDSVKGFLNEWKG
DLWSLVGIPSPENDFETNDAILLGYTVAWFLGELTAVDKQHAIIAHFHEWLAGVALPLCR
KRMIDVVTIFTTHATLLGRYLCAAGDVDFYNNLEKFDVDQEAGKRGIYHRYCIERAAAHT
ADVFTTVSQITAYEAEHLLKRKPDGILPNGLNVIKFQAVHEFQNLHALKKEKINEFVRGH
FHGCFDFDLDNTVYFFTAGRYEYKNKGADMFIEALARLNYRLKVAGSKLTVVAFIIMPAK
NNSFTVEALRGQAVVKSLENTVNEVTNSIGKRIFDHAMKFPNNGITSEIPVNLDELLKPS
DKVLLKKRVLGLRRAPGELPPIVTHNMVDDARDPILNQIRHVQLFNNSSDRVKVIFHPEF
LNANNPILGLDYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGAYMEDL
IETNQAKDYGIYIVDRRFKNPDESVEQLVDYMEEFCKKTRRQRINQRNRTERLSDLLDWK
RMGLEYVKARQLALRRAYPEQFKQLVGADLSDTNMDSLAGGKKLKIARPLSVPGSPRESR
SGSVSVAYMTPGDLGTLQDANNADDYFNLSLTGAHDDDDEQGPFVDDN
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgactcgtgatttacaaaaccatctattattcgaaaccgcaacagaagtggccaacaga
gtgggtgggatctattccgtcctaaaatctaaagctccaataacagtagcccaatataaa
gacaattactgtctaattggtcccctaaataaagcaacataccaaaatgaagtagaccaa
ctagattgggaatctcctgaaacattccctgatgaattgaaaccaattcaaactgcatta
cacgctatgcgttccagaggggtcaatttcatctatgcaaaatggttaatcgagggatct
cctcgtgttatcctattcgatttggattcagttaagggattcttaaacgaatggaaggga
gatctgtggtccttggtggggatcccatctcctgaaaatgatttcgaaactaatgacgct
atattgttaggttatacagtggcttggttccttggagaattgactgcagttgataaacaa
catgccattattgcacatttccatgaatggcttgctggtgtagcattaccattgtgtcgt
aagagaatgattgatgtcgttactatctttactacgcatgctacccttttagggagatat
ttatgtgccgctggtgatgtagatttttataataacttggaaaaatttgatgtcgatcaa
gaagctggtaaaagaggaatttatcatagatattgtattgaaagagccgctgctcatact
gcagatgttttcaccactgtttcacaaatcactgcttatgaagctgagcatcttttgaaa
aggaaaccagatgggattttaccaaatggtttgaacgttattaaatttcaagctgttcat
gaattccaaaatttacatgctttgaaaaaggaaaagattaatgaatttgttagaggccat
ttccatggttgtttcgatttcgatttggataatactgtttatttctttacagctggtaga
tatgaatataaaaataaaggtgcagatatgtttattgaggcattagcaagattaaattat
agattaaaagttgctggttctaaattgactgtcgtggcattcattattatgcctgccaaa
aataattcatttactgtggaagctttaagaggtcaagctgtagttaaatctttggaaaat
actgttaacgaagtgacaaactcaattggtaaaagaatctttgatcatgcaatgaaattc
cctaataatggtataacgtcggaaattccagtcaatttagacgaattgttgaaaccttca
gataaagtcctcttaaagaaacgtgtgcttggtttgagaagggcacctggtgaattacct
ccgattgtaacacataatatggttgatgatgcaagagatccaatcctaaatcaaattaga
catgttcaattatttaataattcatctgatagagttaaagttatttttcatcctgaattt
ttgaacgccaataatccaatcttaggcctagattatgatgaattcgttcgtggttgccac
ttaggtgttttcccatcatattatgagccttggggatatacaccagctgaatgtaccgtt
atgggtgttccttcaattactactaatctatcaggattcggtgcttatatggaagattta
attgaaactaatcaagctaaagattatggtatttacattgtggatcgtagatttaagaat
ccagatgaatctgtcgaacaattggttgattatatggaagaattctgtaaaaagacaaga
agacaaagaattaaccaaagaaacagaacagaaagattatcagatttattagactggaaa
cgtatgggtctagaatatgttaaagctagacaattagcattacgtagagcatatcctgaa
caatttaaacaattggttggtgcagacctaagtgatactaatatggactcgttagctggt
ggtaagaaactcaagattgcaagaccactaagtgtcccaggttcacctagagaatctagg
tcaggcagtgttagtgttgcatatatgacaccaggtgacttgggtactctacaggatgcc
aataatgccgatgattacttcaatctgagccttacaggcgcgcatgatgacgacgatgaa
caaggtccattcgtagatgataactga

DBGET integrated database retrieval system