KEGG   Naumovozyma dairenensis: NDAI_0H00220Help
Entry
NDAI_0H00220      CDS       T02234                                 

Gene name
NDAI0H00220
Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ndi  Naumovozyma dairenensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    NDAI_0H00220 (NDAI0H00220)
Enzymes [BR:ndi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     NDAI_0H00220 (NDAI0H00220)
Exosome [BR:ndi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NDAI_0H00220 (NDAI0H00220)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:complement(30959..33391)
Genome map
AA seq 810 aa AA seqDB search
MPFLISSSYPNNTRLTITRLFKTSSKVINSLQRKPVLTYINTFRNNIHSYKQTKLQLQSQ
LQLQLQSTIKRTLTMPTTSSLSADTTGTTTGTTTGTATATTSNNNIEPQQLRTASNDGSH
IPLIASIDVGTTSSRVILFNKIGQEVEKHQIEYSTSASKEKFSVLGKRRFSTEFSIPTPA
PSTIGNEEEQANLEPVSKMAKPTPIFTAEGISIEQNKDIEIEDLILLDKETKLKRESTPI
HISESSTSTNEPPTKIATHLSSGPTLTYPRPGWIQCNPMTLLINIIQCLGSTIKSISKVN
KYRETNNLPLYKVHCIGITNMRETTFVWSKKTGLPIVNYGILWNDTRNLKIIKHLQESTP
NVVQKMLAKKTGLPLFSTYFSSSKLKWLLNNEPLVLKAYNEGDLMFGTLDTWIIYNLTPN
KTFVTDVTNASRTGFMNIETLQYDNELLSFWGLDPNLINLPKIVSSAEYYGDFKIPRFTK
NFIAPDIWNELTNFQAVKIPIQGCIGDQTASLVGQMAFKPGSAKCTYGTGCFLLYNTGKE
KLTSENGALTTPAYWFPNLSGEDSKPHFALEGSIAVGGAVVQWLRDNLRLIPKSEHVGPL
ASRVRDSGGVVFVPAFNGLFAPYWDPDTRATIMGISQSTTASHIARAAIEGVCFQVRAIL
KAMSGDKIEDGYEKGTVVTLSVDGGMSKSDEVMQIQADILGPCIKLRRSPIVECTALGAA
IAANMAYKNVEDRVLWKDLNDAKKWVMYNGYSKDDNIPQLMHPSLKIFRGKLDDEDRRKH
WKLWQTAVKRSTGWLKDVDGEHEEVPEVTP
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atgccttttcttatttcatcttcttatccaaacaatacaagactaacaataactcgtcta
tttaagacttcttccaaagtaataaactcactccaaaggaaacctgtactaacatatata
aacacttttagaaataatattcattcttacaaacaaacaaagttacaattacaatcacaa
ttacaattacaattacaaagcaccatcaaaaggacattgactatgccaactacatcgtct
ctgtcagctgataccactggcactactactggcactactactggcactgccactgccaca
acttccaataacaatattgaaccgcagcaattaagaactgcatccaatgatgggtctcat
attcccttaattgcatccatcgatgtgggtacgacttcttcaagagtcatcttatttaac
aaaattggtcaagaagtggaaaaacatcaaattgaatattccacttctgcttcaaaagag
aaattttcagtcttaggtaagagaagattctctactgaattctccattccaactccagca
ccttccactatcggtaatgaagaagaacaagcaaatttagaacctgtttccaaaatggcg
aaaccaacacctatcttcacagcggaaggtatctccatcgaacaaaataaagatatagaa
attgaagatttgattctattagataaagaaactaaactgaaaagagaatcaactccaatt
catatttcagaatcatccacttctacaaacgaaccaccaacaaaaatagccactcatctt
tcaagtggtccaactttaacttatccaagaccaggttggattcaatgtaatccaatgact
ttattaattaatatcatacaatgtcttggttccacaataaaatcaatttccaaagttaat
aaatatagagaaacaaataatttacctctatataaagttcattgtataggaattacaaac
atgagagaaactaccttcgtttggtctaaaaaaacaggtttacctatcgtaaattatggt
atcctatggaatgatacaagaaatttgaaaattattaaacatttacaagaatcaacccct
aatgtggtccaaaaaatgttagctaaaaagacaggtttacctttattctcaacttatttc
tcctcttctaaattgaagtggttattaaataatgaaccactagtattaaaagcttataac
gaaggtgatttgatgtttggtactttagatacatggatcatttataatctgactccaaat
aaaacattcgttacagacgttactaacgcttcaagaacagggttcatgaatattgaaact
ttacaatatgataatgaattgttatcattttggggattagatccaaacttaattaattta
ccaaaaatagtttcatcagctgaatattatggagattttaaaataccaagatttactaaa
aatttcattgctccagatatttggaatgaattaactaatttccaagccgtgaaaatccca
attcaaggttgtatcggtgatcaaactgcatcgctagtgggacaaatggcattcaaacca
ggttccgctaaatgtacttacggaacaggttgtttcctactatataatactggtaaagaa
aaattaacctctgaaaatggtgcattaactactccagcttattggttccccaatttatcc
ggtgaagattcaaaaccacattttgccctagaggggtccattgctgtaggtggtgcagtg
gtacaatggttaagagataacttacgtttgattccaaaatctgaacatgtgggacctttg
gcatcccgtgtacgtgattctggcggtgttgtgttcgtccctgcattcaatggactattt
gctccttattgggaccctgatacaagagctactatcatgggtatctcacaatctactaca
gcatcacatattgctagagctgccattgaaggcgtttgtttccaagttagagccattttg
aaagctatgagtggagataagattgaagatggttatgaaaagggtaccgtagttacattg
tctgttgatggtgggatgtctaaatctgatgaagtcatgcaaattcaagctgatatctta
ggaccttgtattaaattaagaagatctcccattgtggaatgtactgcattaggtgctgca
attgcggcaaatatggcttacaaaaatgttgaagatagagtcctttggaaagatttaaat
gatgccaaaaaatgggtcatgtataatggttactctaaagatgataatattccacaatta
atgcatccaagtttaaaaatttttagagggaaacttgatgatgaagatagaaggaaacat
tggaaattatggcaaactgcagttaagagatcaactggttggttaaaagatgtagatgga
gaacatgaagaagtccccgaagtgaccccttag

  All links  
No link information was found.   
DBGET integrated database retrieval system