KEGG   Naumovozyma dairenensis: NDAI_0H00580Help
Entry
NDAI_0H00580      CDS       T02234                                 

Gene name
NDAI0H00580
Definition
(RefSeq) hypothetical protein
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
ndi  Naumovozyma dairenensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NDAI_0H00580 (NDAI0H00580)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NDAI_0H00580 (NDAI0H00580)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NDAI_0H00580 (NDAI0H00580)
Enzymes [BR:ndi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NDAI_0H00580 (NDAI0H00580)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:complement(132136..134265)
Genome map
AA seq 709 aa AA seqDB search
MSEQLRQTFAQAKLENRNTLVTFMTAGYPTVDATIPILKGFQDGGVDVVEIGLPFSDPIA
DGPTIQVANTVALDNGVTMEKTLELVRKARAEGFTLPIILMGYYNPILNYGEEKFIKDAA
DAGANGFIIVDLPPEEAVKVRNFVASVGLSLVPLVAPSTTDDRLELLAKLADSFVYVVSR
MGTTGAQTSVASNLDQLVNRVRKYTKDTPLAVGFGVATREHFKAVGSMADGVVIGSRIVS
LCAQAKDGEHYNVAKNYVEEILNNVKHKILTKDEYIELKDRSIEAAKSHNEPVNTFHEEH
KHPIRFGDFGGQYVPEALHACLRELEKGFDEAVADPTFWEEFRSLYSYIGRPSSLHRAER
LTQHCGGAQIWLKREDLNHTGSHKINNALAQVLIAKRLGKSNVIAETGAGQHGVATATAC
AKFGLKCTVFMGAEDVRRQALNVFRMRILGAEVVSVTNGTQTLRDATSEAFRNWVTNLST
TYYVVGSAIGPHPYPTLVRTFQSVIGQETKEQFAALNNGKLPDAVVACVGGGSNSTGMFS
PFEHDLSVKLFGVEAGGDGLDTDHHSATLTAGRPGVFHGVKTYVLQDNDGQVHDTHSVSA
GLDYPGVGPELAFWKATGRAQFMAATDAEALEGFKLLSQLEGIIPALESSHAVYGACQLA
KTMKPEEHLIINISGRGDKDVQSVAEVLPKLGPKIGWELRFQEDPSVGN
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaacaattaagacaaacttttgctcaagcaaaattggaaaatcgtaatacctta
gtcacattcatgactgcaggctacccaaccgtcgatgccacaattccaatcctcaagggg
ttccaagatggtggtgtcgatgtcgtcgaaataggtttgccattctctgatcctattgca
gatggtccaactattcaagttgcaaatactgtcgctttggacaatggtgtcactatggag
aaaactttagaattagttagaaaggcaagagctgaagggtttactctacctatcatccta
atgggttactataatccaatcttaaattacggtgaagagaagttcattaaagatgcagcg
gatgcaggtgcgaacgggttcatcattgttgatttaccacctgaagaagctgttaaagtt
agaaactttgttgccagtgtcggattaagtttggtcccattggttgctccatccacgact
gatgatagattagaattactggctaagttggccgactccttcgtttatgtcgtctcaaga
atgggtactacaggtgcccaaacttcagtcgcttccaatctggatcaattagtcaacaga
gtaagaaaatacacaaaggatactccattggctgtcgggttcggtgttgcaaccagagaa
catttcaaagctgtcggttccatggctgacggtgttgtcatcggttctagaatcgtttct
ctttgcgctcaagccaaagatggagagcattataatgttgctaagaactatgttgaagaa
atcctaaataatgtcaaacataagatcttaacgaaggatgagtatattgaattgaaagat
cgctctattgaagctgccaagtctcataatgaaccagtcaatacattccatgaagaacat
aaacatcctatcagattcggtgattttggtggtcaatacgttccagaagctttacacgcc
tgtcttagagaattggaaaaaggttttgacgaggctgttgctgatccaacattctgggaa
gaattcaggtcattatattcctacattggtcgtccatcttcattacacagagctgaaaga
ctaacacaacactgtggaggggctcaaatctggttgaaaagagaagatttaaaccataca
ggttcccataagataaataacgctttagctcaagtcttgattgctaagagattaggtaaa
agtaacgtgattgctgagactggtgctggtcaacatggtgtcgccacggccactgcttgt
gccaaattcggtctaaaatgtacagtcttcatgggtgctgaagatgtccgtcgtcaagct
ctaaacgttttcagaatgagaattcttggtgctgaggttgtttccgttactaacggtacc
caaactttgagagatgccacttctgaagctttccgtaactgggtcacaaacttaagtaca
acttattacgttgttggttcagctatcggtcctcatccatacccaactttagttcgtact
ttccaaagtgttattgggcaagaaacaaaggaacaatttgccgcattaaacaatggtaaa
ttgccagatgctgttgttgcttgtgtcggtggtggttcaaactctactggtatgttctcg
cctttcgaacatgatctttccgttaaattattcggtgtagaagctggtggtgatggtctt
gatactgatcatcattcagcaacattgactgctggtagacctggtgtatttcacggtgtt
aagacatacgtgcttcaggataacgatggtcaagttcatgatacccattctgtttccgct
gggttagattatccaggtgtcggtccagaattagctttctggaaggctactggtcgtgct
caatttatggctgctacagatgctgaagctttagaaggtttcaaactattatctcaatta
gaaggtattattccagctttagaatcttctcacgctgtctacggggcttgtcaattagct
aaaactatgaaaccagaggaacatctcattatcaatatctctggtagaggtgacaaagat
gtccagagtgttgctgaggttttacctaaattaggtccaaagattggctgggaattaaga
ttccaagaagatccgtcagttggcaattaa

DBGET integrated database retrieval system