KEGG   Naumovozyma dairenensis: NDAI_0H01480Help
Entry
NDAI_0H01480      CDS       T02234                                 

Gene name
NDAI0H01480
Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
ndi  Naumovozyma dairenensis
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NDAI_0H01480 (NDAI0H01480)
Enzymes [BR:ndi01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     NDAI_0H01480 (NDAI0H01480)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     NDAI_0H01480 (NDAI0H01480)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:complement(358551..359087)
Genome map
AA seq 178 aa AA seqDB search
MIEIYVHDDKDDIDFRQSHNSGVSVSPERITKLGIIAGHYRSICEVNNLASERNYKNRDC
ITLNVETFNNEEAQLLAKLNIFYEEHLHEDEEIRYCVEGSGYFDVKDPTNNEWIRCKLYP
GDLLIIPAGIYHRFTLTTDNFIKAVRLFKEEPKWEAHNKSTVTDQLPIRKQYLKTIKP
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaatatatgttcatgatgacaaagatgatatagactttagacagtctcataat
tcgggcgtatcagtatcacctgagcgtatcactaaattaggaataattgctggtcattat
agatccatttgtgaggtcaataacttagctagtgaaagaaattacaagaatagggattgt
attactttaaatgtagaaactttcaataatgaagaggcgcaattacttgccaaattaaat
atcttctatgaagaacatttacatgaagatgaagagattcgttactgtgttgaaggatca
ggttattttgacgtcaaggacccgaccaataacgaatggatccgttgtaaactgtatccc
ggtgatcttttgattattcctgcaggaatttatcataggtttacacttaccacggacaat
ttcattaaagctgtaagattattcaaagaagaaccaaaatgggaagctcacaataaatca
acggtaacagatcaattgccgataaggaaacagtatttaaaaactataaaaccttga

DBGET integrated database retrieval system