KEGG   Naumovozyma dairenensis: NDAI_0H01750Help
Entry
NDAI_0H01750      CDS       T02234                                 

Gene name
NDAI0H01750
Definition
hypothetical protein
Orthology
K11427  
histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
ndi  Naumovozyma dairenensis
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    NDAI_0H01750 (NDAI0H01750)
Enzymes [BR:ndi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     NDAI_0H01750 (NDAI0H01750)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:419996..422035
Genome map
AA seq 679 aa AA seqDB search
MPSAYQGSSMSATSVSLQETNVVGSPIVATQEANDNNQEEEPSLMHNRDSKKEKNAHLNT
HDKKARNNKTRPADRELRDLLDDVTKYHPQYDYSLPRTFLRSSTKDHKVRGKEHGVDQLG
EKETEGKSPMNQKNSSLQRLKKQRALNKAKKLDTTGQNIVKETFLAENKVNSTHNKFSSS
KRKKLVKEKDLVSVKTKKIKKRKPSPTPEAALDSNSSTPSLSKENSIMSLTRHSESMPTP
NEGLLLPPDYNNNDDEHDKNNLFKEVATDRKEHIKEDFSSTTFVDWSKPTLKLQYPIFNI
EELSQSNFYFDELPIQSTTLTKNVYAHDPENCKLVKLQNPLFANYQEEYHIDFNKDFEKY
NPMSEIGKIIEYTTYIYLPEPFSDQIKIDIIPRLNDAFDNSEIKNFISAIEDYNSSIKRI
PRYKIIEHLATIKEVPISFIHDFLHIVYTRAIHPNVNKLKGYKAFSNFVYGELLPSFLSE
LFGKCDLNSTKTFMDLGSGVGNCVIQASLEYGCEKSFGCEIMPQVCHLTELQQVELQRRS
KLFGFTPSDIEFSLRKSFVNNTRVDQLIPKCDVLLINNFLFDSALNKEVEKIIQNCKPGC
KIVTLKNLRSFGYTIDFFNIENILNRLKVERIDLKEDSVSWTHNGGEYFIATVLENIDES
LFEPEVRSRATRRPTKYSR
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgccttctgcataccagggaagttcaatgtcagctacttctgtcagtttacaagagaca
aatgtcgttggttcacctatagtggcgacgcaagaagctaatgataacaatcaggaggaa
gagccatctttgatgcataatagggacagtaagaaggagaagaatgcacatctaaataca
catgacaagaaagctagaaacaataaaactagacctgctgatagagaacttcgagattta
ttagatgatgttaccaaatatcatcctcaatatgactactccttacctcgaactttcttg
agaagttcaacaaaagatcataaagtacgagggaaggaacatggagtagatcaacttgga
gagaaggaaacagaaggaaagagtccaatgaaccaaaaaaattcatctttacaaagattg
aaaaagcaaagggcattgaacaaagcaaagaaattggatactacgggacaaaatatcgtt
aaagaaacgttcctggcagaaaataaagtaaatagtactcacaacaaattctcttcttcc
aagagaaagaaactagtgaaagagaaagatctagtttcagtaaaaactaaaaaaataaag
aaaagaaaaccgtcacctacaccagaagcagctcttgattcaaattcatcaaccccatct
ttgtcaaaggaaaattcaattatgtctttaacgagacattcagaatcaatgccaacgccg
aacgagggattacttctccctccagattacaacaacaatgacgatgaacacgataaaaat
aacttatttaaagaagtagcgacggatagaaaagagcatataaaagaggatttctcatca
acgacgtttgtagattggagtaaacctactttaaaacttcaatatccgatatttaacata
gaagagctgtcccaatcaaacttttatttcgacgagttaccaatacaatcaacaacgtta
acaaagaatgtatatgctcatgatccagaaaactgtaagttggtaaaattacaaaatcca
ttatttgcaaattatcaagaggaatatcatattgattttaacaaagattttgaaaaatat
aatccaatgagcgaaattggtaaaattattgaatatacaacttatatatacttaccagaa
ccattttctgatcaaatcaaaattgatataataccaaggttgaatgatgcatttgataat
tcagaaattaaaaactttatcagtgcaatagaggattataattcctcaataaaacgtatc
ccaaggtacaaaataatagagcatctagctacaataaaagaagtaccaatatctttcatt
catgattttttgcatatagtttatacaagagccatccatccaaatgttaataaactgaaa
ggttataaagcatttagtaattttgtttatggcgaattattaccaagttttttatctgaa
ttatttggaaaatgtgacttaaactcaacaaaaacgtttatggatttgggttctggtgtc
ggaaattgtgtcattcaagcatcactagaatacggctgtgaaaaaagttttggttgtgaa
attatgcctcaagtttgccatctgactgaattgcaacaagttgagttacaaagaagatct
aaattgttcgggtttacaccttcagatattgagttttctttgcggaaaagttttgttaat
aatacaagagttgatcaattaattccaaaatgtgacgtattattaatcaataatttctta
tttgatagtgcactgaataaagaagtcgaaaagattatccaaaattgtaaacctggttgt
aagattgtaactttgaagaacttacgaagttttggttatacaatcgatttcttcaacata
gaaaacatcttaaatagattaaaggtggaaagaatagacttgaaagaggatagtgtctct
tggactcataatggaggggaatatttcatagccacagtattggaaaatatagatgaatct
ttgtttgaaccagaggtaaggagtagagccactagaagaccgacaaaatatagcaggtaa

DBGET integrated database retrieval system