KEGG   Naumovozyma dairenensis: NDAI_0H01850Help
Entry
NDAI_0H01850      CDS       T02234                                 

Gene name
NDAI0H01850
Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ndi  Naumovozyma dairenensis
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ndi00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:complement(440637..441197)
Genome map
AA seq 186 aa AA seqDB search
MSRPIVISGPSGAGKSTLLKKLFQEYPDTFGFSVSSTTRNPREGEVHGKDYNFATVEEFK
QMIDANKFIEWAQFSGNYYGTTVDSVKEVSSSGKTCILDIDMQGVKSVKDKTDLNARYLF
IAPPSIDDLRKRLEGRGTETEESLNKRLSAATAEMEYANTGAHDKIIVNDDLDKAYAELK
DFIFGN
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgcccaatcgttatctcaggtcccagtggtgctggtaaatccacattattgaaa
aaattgtttcaagaatatccagacacatttggattcagtgtatcttctaccacaaggaac
ccaagagaaggtgaagttcatggtaaagattataattttgccactgttgaagaattcaaa
caaatgattgatgctaataaatttattgaatgggctcaattttctggtaattattacggt
accactgtcgattccgttaaagaagttagttcttctggtaagacttgtatcttggatatt
gatatgcaaggtgttaaatctgtcaaagataaaactgatttgaatgctagatatttgttt
attgctccaccatctattgatgatttaaggaaaagattggaaggtagaggtactgaaact
gaagaatctttgaataagagattatctgctgctaccgctgaaatggaatatgctaacaca
ggtgcacatgataaaattattgtcaatgatgatctagataaggcttatgctgagttgaag
gactttattttcggtaactaa

DBGET integrated database retrieval system