KEGG   Naumovozyma dairenensis: NDAI_0H02010Help
Entry
NDAI_0H02010      CDS       T02234                                 

Gene name
NDAI0H02010
Definition
(RefSeq) hypothetical protein
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ndi  Naumovozyma dairenensis
Pathway
ndi00010  Glycolysis / Gluconeogenesis
ndi00620  Pyruvate metabolism
ndi00640  Propanoate metabolism
ndi00680  Methane metabolism
ndi01100  Metabolic pathways
ndi01110  Biosynthesis of secondary metabolites
ndi01130  Biosynthesis of antibiotics
ndi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NDAI_0H02010 (NDAI0H02010)
   00620 Pyruvate metabolism
    NDAI_0H02010 (NDAI0H02010)
   00640 Propanoate metabolism
    NDAI_0H02010 (NDAI0H02010)
  Energy metabolism
   00680 Methane metabolism
    NDAI_0H02010 (NDAI0H02010)
Enzymes [BR:ndi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     NDAI_0H02010 (NDAI0H02010)
Lipid biosynthesis proteins [BR:ndi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   NDAI_0H02010 (NDAI0H02010)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 11495906
NCBI-ProteinID: XP_003671618
UniProt: G0WF14
Position
8:491292..493466
Genome map
AA seq 724 aa AA seqDB search
MTPVPIAIPKNTGTNNQQAEQIKDLKSKAAAEASQNTKEYEHLTAVKVVQQLPINDRLQP
NIKSHYSPHLNGIQEYKTLYDQSINDPKKFFGDKAHQFINWFKDFNQVYIPDLDKDSSGN
TPSFENNAWFLNGELNACYNCVDRHALKNPNKVALIYEADDPSKNESYKLTYKELLEQVS
QLAQVLKYSMNVQKGDTVAVYMPMIPQALITLLAIVRIGAIHSVVFAGFSSNSLRDRINN
AGSKVVITTDESCRGSKIIETKRIVDDALRETPIVEKVLVYKRTNNPAVNFNPQIDLDWS
TEMKKYKTYYPCEPVDSEHPLFLLYTSGSTGTPKGVQHSTAGYLLNVLLTMRYTFDTHQE
DVFFTAGDIGWITGHSYVVYGPLSYGCTTVVFEGTPTFPNHSRYWDIIDNYKVTQFYVAP
TALRLLKRAGNDHIKPYSLKSLRCLGSVGEPIAAEVWEWYSKEIGHNEIPIIDTYWQTES
GAHLITPMAGGVTPMKPGSASFPFFGIDPIILDPNTGEELGTGINDDGHAEGILAIRKPW
PGFARTIWKNHDRYVETYLTPYQGYYFTGDGAVKDKDGYIWILGRVDDVVNVSGHRLSTA
EIEAAIIQDNSVAECAVVGFNDELTGQAVAAFVVLKNKSSWSTASDAELTDIKKHLILTV
RKDIGPFAAPKLIVLVDDLPKTRSGKIMRRILRKILAGEADQLGDITTLSNPDVVKHLIE
SVKL
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgactcctgtaccaattgccattccaaagaacactggaacaaacaatcaacaagctgaa
caaattaaagatttgaaatcaaaagcagccgctgaagcatctcaaaacacaaaggaatat
gaacatttaactgcagtaaaggtagttcaacaattaccaatcaatgacagattacagcca
aatataaaatctcactattctcctcatctcaatggaattcaagaatataaaacactatat
gatcaatcaattaatgaccccaaaaaattcttcggagataaagctcatcaattcattaat
tggtttaaagattttaatcaagtttatatcccagatttagacaaagattcatcaggtaat
actccatcttttgaaaataacgcttggttccttaacggtgaattaaatgcttgttacaat
tgtgtcgatagacatgcattaaagaatccaaataaagttgctttaatttatgaagctgat
gatccttctaaaaatgaaagttataaattaacttacaaagaattattagaacaagtttct
caattagctcaagttttaaaatattcaatgaatgttcaaaaaggtgatacagtcgctgta
tacatgccaatgataccacaagctcttatcactttattagctatagttcgtatcggtgcc
attcattccgttgtctttgcaggtttctcatcaaattcattaagagatagaattaataac
gcaggttcaaaagtagtaatcaccactgatgaatcctgcagaggtagtaaaatcattgaa
accaaaagaattgtagatgatgcattacgtgaaactccaatagtggaaaaagttttagtt
tacaaacgtacaaataatcctgctgtcaatttcaatccacaaattgatttagattggtct
acagaaatgaaaaaatataaaacttattacccatgtgaacctgttgattctgaacatcca
ttattcctcttatatacctcgggttccactggtacccccaagggtgttcaacattctaca
gcaggttacttattaaatgtcctattaaccatgcgttacactttcgatactcatcaagaa
gatgtctttttcacagctggtgatataggttggattacaggtcattcatacgttgtatac
ggtccattatcatacggttgtaccactgtagtcttcgaaggtactccaacattccctaat
cattctcgttattgggatatcattgacaattataaagtaacacaattctacgtagctccc
accgcattacgtctcttaaagagagcaggaaatgatcacattaaaccatattcattaaaa
tcattacgttgtttgggctcagtaggtgaaccaatcgctgctgaagtttgggaatggtac
tccaaagaaattggtcataatgaaattccaataattgatacatattggcaaactgaatca
ggtgctcatttaattactcccatggctggtggtgtcactccaatgaaaccaggatctgca
tcattcccattctttggtattgatccaattatattggatccaaataccggtgaagaatta
ggtacaggaataaatgatgatggccatgctgaagggatcttagctattaggaaaccttgg
ccaggattcgctagaactatttggaaaaatcatgatagatatgtggaaacttatttaact
ccatatcaaggttattatttcactggtgatggtgctgttaaggataaagatggatacatt
tggattcttggtcgtgtagatgatgtcgttaatgtctctggtcatagattatctactgct
gaaattgaagctgccattattcaagataatagtgttgcagaatgtgcagtcgttggattt
aatgatgaattgactggtcaagctgttgctgcatttgtagtattgaaaaataaatcaagt
tggtcaacggcaagtgatgctgaattaacagatattaagaaacatttgatcttaactgtg
agaaaggatattggtccatttgctgcaccaaaattaattgttttagttgatgatttacca
aagacaagatcaggtaagattatgagacgtatcttaaggaaaattttggctggtgaagct
gatcaattgggtgatattactacattgtcgaaccctgatgttgttaaacatttgatcgaa
tctgttaaattatga

DBGET integrated database retrieval system