KEGG   Naumovozyma dairenensis: NDAI_0H02160Help
Entry
NDAI_0H02160      CDS       T02234                                 

Gene name
NDAI0H02160
Definition
(RefSeq) hypothetical protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ndi  Naumovozyma dairenensis
Pathway
ndi00010  Glycolysis / Gluconeogenesis
ndi00071  Fatty acid degradation
ndi00350  Tyrosine metabolism
ndi01100  Metabolic pathways
ndi01110  Biosynthesis of secondary metabolites
ndi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NDAI_0H02160 (NDAI0H02160)
  Lipid metabolism
   00071 Fatty acid degradation
    NDAI_0H02160 (NDAI0H02160)
  Amino acid metabolism
   00350 Tyrosine metabolism
    NDAI_0H02160 (NDAI0H02160)
Enzymes [BR:ndi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NDAI_0H02160 (NDAI0H02160)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Epimerase AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 11495921
NCBI-ProteinID: XP_003671633
UniProt: G0WF29
Position
8:528551..529696
Genome map
AA seq 381 aa AA seqDB search
MLRLTTGRFVSSTTTTTSNLIFKNFLRLQSTAAGSIPKTQKAVVFYENGGPLHYKDIPVP
KPKANEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGSGVVMQVGENVKGWKVGD
LAGIKWLNGSCMACELCETGNESNCEHADLSGYTHDGSFQQYATADAVQAARIPEGTNLA
EVAPILCAGITVYKALKEADLKAGQWVCISGAAGGLGSLAVQYAKAMGYRVIGIDGGKAK
EELFKSMGGEVFIDFTKSKDMVKDIQEATKGGPQGVINVSVSEAAISLSTQYVRPTGTVV
LVGLPAHAYVKSEVFSHVVKSINIKGSYVGNRADTREALDFFARGLIKSPIKIVGLSELP
KVYDLMEKGQILGRYVVDTSK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgttaagattaacaacagggagatttgtctcttcaacaacgacaacgacatccaattta
atattcaaaaacttcctaagattacaatcgaccgcggctggatcaatccctaagacccag
aaggccgttgtcttctatgaaaacggtggtccgttacattacaaggatatccctgtcccc
aaacctaaagctaatgaaatcttaatcaacgtcaaatactcaggtgtctgtcacactgac
ttacacgcttggaagggtgactggcccctacctaccaaactgcctctagtcggtggccac
gaaggtagtggtgtcgtcatgcaagtcggtgagaacgtcaaaggttggaaagtgggtgac
ttggcaggaatcaaatggctgaatgggtcatgtatggcttgtgaattatgtgaaactggg
aatgaatccaactgtgaacatgcggatttgtctgggtatactcatgatgggtcctttcaa
caatatgctactgcagatgctgttcaagcagctagaatcccagaagggactaatttggct
gaagtggctcctatcttgtgtgctggtattactgtctataaggctttgaaagaagctgat
ttgaaagcgggccaatgggtttgtatatctggtgctgcaggtgggctaggttcccttgct
gttcagtatgctaaggcaatgggctatagagttattggtatcgatggtggtaaggcaaag
gaggaactgtttaaatccatgggtggtgaagtattcattgatttcacaaaatctaaagat
atggtgaaagatattcaagaagctaccaagggtggtccacaaggtgttattaacgtttca
gtttccgaggctgctatttcattatcgacacaatacgttagacctactggtaccgttgtt
ttagtagggttaccagctcatgcatatgttaaatccgaagtcttctctcatgttgtaaaa
tccattaatatcaagggttcgtatgttggtaacagagctgacactagagaggctttagat
ttcttcgctagaggtctaatcaaatctcctatcaagatcgttggtctatctgaattacca
aaagtatacgacttaatggaaaagggccaaatcctaggtagatatgtcgtcgatacttcc
aaatag

DBGET integrated database retrieval system