KEGG   Naumovozyma dairenensis: NDAI_0H02300Help
Entry
NDAI_0H02300      CDS       T02234                                 

Gene name
NDAI0H02300
Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ndi  Naumovozyma dairenensis
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ndi00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:558882..559775
Genome map
AA seq 297 aa AA seqDB search
MPVQNTDTTVVLTHPHNKETSVTILKYGATVYSWKLNSEEQLWLSTAAKLDGSKPVRGGI
PLVFPVFGKNETDELLSKLPQHGLARNSTWEFLGQTKENPPTVQFGLNEKIANPELTALW
PRSFQLVLTVELGADYLKTGIEVDNTSNTEALKFNWLFHTYLRIEDIEDTMVSNLAGMHL
YDQLIKESFVDKHPVITFHQETDCIYSNVDADRNIQVVSRGKQIHTLKRENLPDAVVWNP
WVKKSEGMGDFEPKIGYKNMVCVEPGHVHDFIELAPGKKWNASQLLYKDELKYQAIQ
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtccaaaataccgatacaacagttgtcttgactcatccacacaacaaagaaact
tctgtaaccatcttaaagtatggtgccacggtatattcatggaagttaaattctgaagaa
caattatggttatctactgccgctaaattagatggttccaaaccagtcagaggtggtatt
ccattagtcttccctgttttcggtaagaacgaaactgatgaattattaagcaaattgcca
caacatggtcttgctagaaactccacttgggaatttttaggtcaaacaaaggaaaatcca
ccaactgttcaatttggattgaatgaaaaaattgctaatccagaattgactgccttatgg
ccaagatctttccaattggtcttgaccgttgaattaggtgccgattatttgaaaacaggc
attgaagttgataatacatctaacacagaagcattgaaattcaattggttgttccatact
tacttaagaatcgaagacattgaagatacaatggtttctaacctagccggtatgcatctt
tatgatcaattgattaaggaaagtttcgttgataagcatccagtcattacattccaccaa
gaaactgattgtatttactctaatgttgatgctgatcgtaacatccaagtggttagtaga
ggtaagcagattcataccttgaaaagagaaaacttgccggatgctgtcgtttggaaccca
tgggttaagaaatctgaaggaatgggcgatttcgaaccaaagattggttacaagaacatg
gtttgtgtcgaacctggccatgttcacgatttcattgagttggcacctggtaagaaatgg
aatgcttctcaattgctatataaggatgaattgaaataccaagccattcaatag

DBGET integrated database retrieval system