KEGG   Naumovozyma dairenensis: NDAI_0H02300Help
Entry
NDAI_0H02300      CDS       T02234                                 

Gene name
NDAI0H02300
Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ndi  Naumovozyma dairenensis
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NDAI_0H02300 (NDAI0H02300)
Enzymes [BR:ndi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     NDAI_0H02300 (NDAI0H02300)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:558882..559775
Genome map
AA seq 297 aa AA seqDB search
MPVQNTDTTVVLTHPHNKETSVTILKYGATVYSWKLNSEEQLWLSTAAKLDGSKPVRGGI
PLVFPVFGKNETDELLSKLPQHGLARNSTWEFLGQTKENPPTVQFGLNEKIANPELTALW
PRSFQLVLTVELGADYLKTGIEVDNTSNTEALKFNWLFHTYLRIEDIEDTMVSNLAGMHL
YDQLIKESFVDKHPVITFHQETDCIYSNVDADRNIQVVSRGKQIHTLKRENLPDAVVWNP
WVKKSEGMGDFEPKIGYKNMVCVEPGHVHDFIELAPGKKWNASQLLYKDELKYQAIQ
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtccaaaataccgatacaacagttgtcttgactcatccacacaacaaagaaact
tctgtaaccatcttaaagtatggtgccacggtatattcatggaagttaaattctgaagaa
caattatggttatctactgccgctaaattagatggttccaaaccagtcagaggtggtatt
ccattagtcttccctgttttcggtaagaacgaaactgatgaattattaagcaaattgcca
caacatggtcttgctagaaactccacttgggaatttttaggtcaaacaaaggaaaatcca
ccaactgttcaatttggattgaatgaaaaaattgctaatccagaattgactgccttatgg
ccaagatctttccaattggtcttgaccgttgaattaggtgccgattatttgaaaacaggc
attgaagttgataatacatctaacacagaagcattgaaattcaattggttgttccatact
tacttaagaatcgaagacattgaagatacaatggtttctaacctagccggtatgcatctt
tatgatcaattgattaaggaaagtttcgttgataagcatccagtcattacattccaccaa
gaaactgattgtatttactctaatgttgatgctgatcgtaacatccaagtggttagtaga
ggtaagcagattcataccttgaaaagagaaaacttgccggatgctgtcgtttggaaccca
tgggttaagaaatctgaaggaatgggcgatttcgaaccaaagattggttacaagaacatg
gtttgtgtcgaacctggccatgttcacgatttcattgagttggcacctggtaagaaatgg
aatgcttctcaattgctatataaggatgaattgaaataccaagccattcaatag

DBGET integrated database retrieval system