KEGG   Naumovozyma dairenensis: NDAI_0H03550Help
Entry
NDAI_0H03550      CDS       T02234                                 

Gene name
NDAI0H03550
Definition
hypothetical protein
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
ndi  Naumovozyma dairenensis
Brite
Enzymes [BR:ndi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     NDAI_0H03550 (NDAI0H03550)
Peptidases [BR:ndi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NDAI_0H03550 (NDAI0H03550)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:complement(865851..867359)
Genome map
AA seq 502 aa AA seqDB search
MSAIETLDFNIKHQGKLYPISIPSKTTTALELKTQAEELTQVPISRQKYMVKGGLSNDSM
TDLDSVIKPNSTIMMLGTPDANLITKPKSQNHFIEDLSPDQQLQKMDSTPIGFQNMGNTC
YMNATLQALYRTDDIRQMILDYKPPAQSSTYNPEDEMHHKIVLEIKRCFENLEKKNFKSV
MPMMLLTVLRKCYPQFAERDPRGGFYKQQDAEELFTQLFHTFSIVFGDKFSNDFTILFKT
TIKDTNNEDDVQIKTDENDLKLQCHISSSTNFMKNGLIESMHESIEKRSEITGVNSTYSV
DKQITKLPKFLTVQYVRFYWKRSTGKKSKILRKVVFPFQLDLSDMLTPEYQQEKIKVRDA
MRQVEKNKLEKERELKKRKLSPTARSTNELMTPREEAETEKAIEESEKEYWLNEYAKCFP
KDLRQGENPSCVYNLIGIITHQGANSESGHYQAFMRDENDENKWYKFNDDKVTVVEKEKI
EALAGGGESDSALILMYKGLGL
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctattgaaactttagattttaatattaaacatcaagggaaactatacccaata
tctataccatccaagaccacaactgctcttgaactaaagactcaggcggaagagttaact
caagtacctatatctcgtcaaaaatatatggttaaaggaggtctttcaaatgactcgatg
acagatttggattcagttattaaacctaattccactataatgatgctagggactcctgat
gctaatttgattaccaaaccaaaatctcaaaatcatttcattgaagatttgtcacctgat
caacaattgcaaaaaatggattccacacctattggattccaaaacatggggaatacttgt
tatatgaacgccacgttacaagctctttatagaactgatgatattagacaaatgatccta
gattataaacctcctgcacaatcatctacatataacccagaggatgaaatgcatcataag
attgtattagaaattaaacgttgttttgaaaatttagagaaaaaaaacttcaaatcagtc
atgccaatgatgcttttaacagtccttagaaaatgttacccacaattcgcagaacgtgat
cctcgaggagggttttacaaacaacaagatgcagaagaattatttactcaattgtttcat
acttttagcattgtctttggtgataaatttagtaatgattttaccatactattcaagacc
acaattaaagatactaataatgaagatgatgttcaaattaaaacagatgaaaatgatttg
aaattgcaatgtcatatatcaagttccaccaatttcatgaagaatgggttgattgaatct
atgcatgaaagtattgagaaaagatctgaaataacaggtgtaaattcaacttattctgta
gataaacaaattactaaattacctaaatttttaacagttcaatatgttagattttattgg
aaaagatctactggtaagaaatcaaagattttacgtaaagttgtcttcccattccaattg
gatctttctgatatgttaactcctgaatatcaacaagaaaagattaaagtacgtgatgca
atgagacaagtggaaaaaaataaattagaaaaggaacgtgaattgaagaaaagaaaatta
agtccaactgcacgttctactaatgaattaatgacaccaagagaagaagcagaaactgaa
aaggccattgaagaaagtgagaaggaatattggttaaatgaatatgctaaatgtttccct
aaggatttacgacagggggaaaatccatcatgtgtttataatttgattgggattataaca
catcaaggtgcaaattctgaatcgggacattatcaagctttcatgagagatgaaaatgat
gaaaataaatggtataaatttaatgatgataaagttactgttgtagagaaggaaaaaatt
gaagctttagctggtggtggtgaaagtgatagcgctttgattttaatgtacaagggactg
ggtttgtag

DBGET integrated database retrieval system