KEGG   Naumovozyma dairenensis: NDAI_0I00480Help
Entry
NDAI_0I00480      CDS       T02234                                 

Gene name
NDAI0I00480
Definition
(RefSeq) hypothetical protein
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ndi  Naumovozyma dairenensis
Pathway
ndi00260  Glycine, serine and threonine metabolism
ndi00750  Vitamin B6 metabolism
ndi01100  Metabolic pathways
ndi01110  Biosynthesis of secondary metabolites
ndi01230  Biosynthesis of amino acids
Module
ndi_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NDAI_0I00480 (NDAI0I00480)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NDAI_0I00480 (NDAI0I00480)
Enzymes [BR:ndi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NDAI_0I00480 (NDAI0I00480)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP DUF2683
Motif
Other DBs
NCBI-GeneID: 11496175
NCBI-ProteinID: XP_003671860
UniProt: G0WFQ6
Position
9:complement(96926..98476)
Genome map
AA seq 516 aa AA seqDB search
MATTSQVYRSTRSSDKETKTFEEVVIQGLAKDGGLFIPPTIPQVSQETLFSKWSKLSFQE
LAFEIMRLYIDSNEIPDADLKQLINRSYSTFRSTEVTPLVKNVTGNNENLHILELFHGPT
YAFKDVALQFVGNLFEYFLQRTNASLPESEKKQITVVGATSGDTGSAAIYGLRGKKDVSV
FILYPTGRISPIQEEQMTTVPDKNVQTLSVKGTFDNCQDIVKAIFADKDFNKRHNVGAVN
SINWARILAQMTYYFYSYFKAIEGKDQSAVKVKFVVPSGNFGDILAGYFAKKMGLPVEKL
VIATNENDILDRFLKSGDYERSDEVAATLSPAMDILISSNFERLLWYLARENLAGNDDLK
AGEIVNGWFHELKSNGKFQVGQAVIDGALKDFASERVSDEETAATIKKIYEESVNPKKYV
LDPHTAVGVCASKRLIAADNNASINYISLSTAHPAKFAEAVNNALSSFEGYSFEKDVLPE
ELKKLSTLPKKLKFIEKADIELVKAAIDEELAKMDL
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggctactacatctcaagtttacagatctactagatcatcagataaagaaaccaaaact
tttgaagaagttgtcattcaaggtctagccaaagatggtggtttattcatcccaccaact
attccacaagtttctcaagaaaccttattttctaaatggtctaagctatctttccaagaa
ttagcttttgaaattatgcgtctttacatcgattccaatgaaatcccagatgctgatttg
aaacaattaatcaacagatcatactccactttccgctccactgaagtcactccattagtg
aaaaacgtcaccggtaacaatgaaaacttacacatcttagaattattccatggtccaact
tacgccttcaaagatgtcgcattacaattcgtcggtaatcttttcgaatatttcttacaa
aggactaatgcatcattaccagaatctgaaaagaaacaaataacagtcgtcggtgcaact
tctggtgataccggttccgccgctatctacggtctaagaggtaagaaagatgtttctgtc
ttcatcctatacccaactggtagaatctctccaattcaagaagaacaaatgactactgtt
cctgataaaaatgttcaaacactatccgtcaagggtacttttgataattgtcaagatatc
gtcaaggctatctttgctgataaggatttcaataaaagacataacgtcggtgctgtcaac
tccattaattgggctagaattttggctcaaatgacttactatttctattcatatttcaaa
gccattgaaggtaaggatcaatccgctgtgaaggttaaattcgtcgtgccaagtggtaat
tttggtgatattttggctggttattttgctaagaaaatggggttacctgtggaaaaatta
gtcattgccactaacgaaaatgatatcttagatagattcttgaaatctggtgactacgaa
agatccgatgaagtcgctgccactttatctcctgctatggatatcttgatttcatccaat
ttcgaaagattactttggtacctagctcgtgaaaatttagctggaaacgatgatttgaaa
gcaggtgaaattgtcaacggttggtttcatgaattgaaatccaatggtaaattccaagtt
ggtcaagctgtcattgatggtgctttgaaagatttcgcttctgaaagagtctccgatgaa
gaaactgctgctactatcaagaagatatatgaagaatcagttaaccctaagaaatacgtc
ttagatccacatactgctgttggtgtttgtgctagtaaaagattaattgccgctgataac
aatgcgtctataaattacatctcattatctactgctcatccagctaaatttgctgaagct
gtcaacaatgccttatcttctttcgaaggttactctttcgaaaaggatgttttacctgaa
gaattgaagaagttgtcaactttaccaaagaaattgaaattcattgagaaagctgacatc
gaattagtcaaggctgctattgatgaagaactagctaaaatggatttataa

DBGET integrated database retrieval system