KEGG   Naumovozyma dairenensis: NDAI_0I00570Help
Entry
NDAI_0I00570      CDS       T02234                                 

Gene name
NDAI0I00570
Definition
(RefSeq) hypothetical protein
  KO
K11262  acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
ndi  Naumovozyma dairenensis
Pathway
ndi00061  Fatty acid biosynthesis
ndi00620  Pyruvate metabolism
ndi00640  Propanoate metabolism
ndi01100  Metabolic pathways
ndi01110  Biosynthesis of secondary metabolites
ndi01130  Biosynthesis of antibiotics
ndi01212  Fatty acid metabolism
Module
ndi_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NDAI_0I00570 (NDAI0I00570)
   00640 Propanoate metabolism
    NDAI_0I00570 (NDAI0I00570)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    NDAI_0I00570 (NDAI0I00570)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    NDAI_0I00570 (NDAI0I00570)
Enzymes [BR:ndi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     NDAI_0I00570 (NDAI0I00570)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     NDAI_0I00570 (NDAI0I00570)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     NDAI_0I00570 (NDAI0I00570)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACC_central Carboxyl_trans CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl Biotin_lipoyl_2 ATP-grasp_3 Dala_Dala_lig_C RnfC_N GxGYxYP_N
Motif
Other DBs
NCBI-GeneID: 11496184
NCBI-ProteinID: XP_003671869
UniProt: G0WFR5
Position
9:118702..125397
Genome map
AA seq 2231 aa AA seqDB search
MSEENLFEETSPKQAYEITDYSSKHSKLPSHFRGLNTIDIAEESPLKEFVKSHGGHTVIS
KILIANNGIAAVKEIRSVRKWAYETFGDDRTIQFVAMATPEDLEANAEYIRMADQYVEVP
GGTNNNNYANVDLIVDIAERANVDAVWAGWGHASENPHLPEKLAKSKRKVVFIGPPGSAM
RSLGDKISSTIVAQSANVPCIPWSGTGINTVKVDKETGLVSVPDDVYQEGCCSSPEDGLV
KAKKIGFPVMIKASEGGGGKGIRQVEREEDFIPLYHQAANEIPGSPIFIMKLAGKARHLE
VQLLADQYGNNISLFGRDCSVQRRHQKIIEEAPVTIAPPEIFAQMEKSAVRLGQLVGYVS
AGTVEYLYSHDEQKFYFLELNPRLQVEHPTTEMVTGVNLPASQLQIAMGIPMHRISDIRV
YYGMNPHSSSEIDFEFKTEKALKTQRKPVPKGHCTACRITSEDPNEGFKPSGGSLHELNF
RSSSNVWGYFSVGNNGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFRTTV
EYLIKLLETEDFEDNTITTGWLDDLISHKMTAEKPDETLAVICGATTQAFINSEKSRQKY
IDDLKRGQVPSKSCLKTMFPVEFIHEGKRYKFTVAKSANDRYTLFINGSKCEVRARKLSD
GGLLIALGGKSHTIYWKQEVSATRLSVDSMTTLLEVENDPTQLRTPSPGKLVKFLVENGD
HIKAGQPYAEIEVMKMQMPLVAQESGVVQLLKQPGSTIVAGDIIAILTLDDPSKVKHALP
FEGLLPDFGSPVVEGTKPAYKFQSLVTTLENILQGYDNQVIMNASLQQLIEVLRDPKLPY
SEWKLQISALHSRLPVDLDEKLSELVDRSAKRSAVFPAKQIAKMLDNAVKQPDTDAQLLS
TLEPLLDITRRYTDGIEAHEHSVFVNFLEEYYDVEKLFSSANSREESVILKLRDENIDNL
DKVALIVLSHAKVSAKNNLILAILKHYQPLCKLSSHVAHIFTTPLQHLVQLESKSTAKVA
LQAREILIQGALPSVKERTEQVEHILKSSVVGTTYGASNSKRTEPDLEILKDLIDSNYVV
FDVLIQFLNHPDPAVAAAAAQVYVRRAYRAYTVGEVRGHASTSNPVIEWKFQLPSAAFSS
IPQMRTKMGMNRAISVSDLTYVVDSEHSPLRTGILVAADHLDDVDTNLSESLGVIPEHAS
TTGPVPDRSGSSSSLSNVANIFVASTEGFENETAILKRIREILDVNKQDLIKSAIRRITF
MFGCTDGSYPKYYTFNGPSYNENETIRHIEPACAFQLELGRMSNFNIKPIFTENRNIHVY
EAVSKTSPLDKRFFTRGIIRTGRISADISIQKYLTSEANRLMSDILDNLEIIDTSNSDLN
HIFINFSAVFDVSPEDVEAAFAGFLARFGKRYLRLRVSSAEIRIIIQDPKTGTPVPLRAL
INNVSGYVVKSELYTEVKNNKGEWVFKSLGKPGSMHLRPIATPYPVKEWLQPKRYKAHLM
GTTYVYDFPDLFHQAAMSQWEKFGLETPLSDSFFIANELIEDENGELTEVEREAGVNSIG
MVAFKVTVKTPEYPRGRQFVIVANDITYKIGSFGPQEDEFFNKVTEYARKRGIPRIYLAA
NSGARIGIAEELVPLYQVAWKDDKDQSKGFEYLYLTPEGMETLKSYGKEKSVLTERVVEN
GEERFIIKTIIGAEEGLGVECLRGSGLIAGATSRAYQDIFTITLVTCRSVGIGAYLVRLG
QRAIQIEGQPIILTGAPAINKVLGREVYSSNLQLGGTQIMYNNGVSHLTASDDLAAVEQI
MEWLSYIPAKRNMPVPILETEDKWDRQIDFIPRVNEPYDVRWMIEGRTLEDGGFEYGLFD
KGSFFETLSGWAKGVVVGRARLGGIPLGVIGVETKTIENLIPADPANPDSRESLIQEAGQ
VWYPNSAFKTAQAIKDFNHGEQLPLMILANWRGFSGGQRDMYNEVLKYGSFIVDALVDYK
QPISIYIPPTGELRGGSWVVVDPTINSDQMEMYADKDSRAGVLEPEGMVGIKYRREKLLG
TMARLDEKYKTLREKLSNKDLSVEEHQDISKQLLIRERQLMPIYNQISIQFADLHDRSQR
MVSKGVIRQELEWVEARRFFFWRLRRRLNEEYLIRRLDVELPEAVRLEKIARLRSWYPAS
VDHENDRQVATWIEDNYQLLDEHLKSLKVESFAQGLAKKIRNDHDNVITGLSEVLKMLSS
EDKEKILKSMK
NT seq 6696 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagaaaacttattcgaagaaacatctccaaaacaagcatacgaaataacagac
tattcgtcaaaacactcaaaactaccatcccatttcagaggtctgaacacaatagatata
gctgaagaatctcccttaaaagaattcgtaaaatctcacggtggtcacacagttatctct
aagatattaatcgcaaacaatggtattgctgccgtaaaggaaattcgttcagtcagaaaa
tgggcctatgaaacctttggtgatgatagaactattcaattcgtagcgatggctactcca
gaagatttggaagctaacgcggaatatattagaatggctgatcaatatgtggaggtacca
ggtggaaccaataataataattacgctaatgtagatcttattgtagatatcgctgaaaga
gctaacgtagatgccgtgtgggctggttggggtcatgcttcagaaaaccctcatttacct
gaaaaattagctaaatcgaagaggaaagttgtattcattggacctcctggaagtgctatg
agatcactgggggataaaatatcttcaactatcgttgctcagtctgcgaatgttccttgt
attccatggtctggaactgggatcaatactgttaaagttgataaagaaactgggttagtc
tccgttcctgatgatgtttatcaagaaggttgttgttcatcaccagaagatggtctagtt
aaagctaaaaaaattggattccccgttatgatcaaagcttcagaaggtggtggtggtaaa
ggtattagacaagtggaacgtgaagaggattttatcccattatatcatcaagctgcaaat
gaaatacccggatctccaatatttattatgaaattggctgggaaggctcgtcatttggaa
gttcaattattagctgatcaatatggtaataatatttcattgtttggtcgtgattgttcc
gtacaaagacgtcatcaaaaaattattgaagaagctcctgtaactattgctcctccagag
attttcgctcaaatggaaaaatctgctgtaagattaggtcaattagtcggttacgtttct
gctggtacagtagagtatttatattctcatgatgaacaaaaattctatttcttagaatta
aatccaagattacaagtggaacatccaaccactgaaatggtcactggtgttaatttacct
gcttcacaattacaaatcgcaatgggtatcccgatgcatagaattagtgatatcagagtt
tattatgggatgaatccacatagttcatctgaaattgatttcgaattcaaaactgaaaag
gcattgaaaacccaaagaaaacctgttccaaagggtcattgcacagcctgtcgtatcact
tctgaagatccaaatgaagggtttaaaccatctggtggttcattacatgaattgaatttc
cgttcttcttccaatgtatggggttacttctcagttggtaacaacggtggtattcattct
ttctctgactctcaattcggtcatatcttcgcattcggtgaaaatagacaagcttcaaga
aaacatatggtcgttgccttaaaggaattatcaattaggggtgattttagaactacagtg
gaatatttaattaaattattagaaactgaagattttgaagataacactattaccacaggt
tggttagatgatttaatttctcataaaatgactgcagaaaaacctgatgaaactttggct
gtcatttgtggtgctacaactcaagctttcattaattctgaaaaatctcgtcaaaaatac
attgacgatttgaaaagaggtcaagttccatcaaaatcttgcctaaagacaatgttccca
gtagagtttattcatgaaggtaagagatataagtttaccgtggcaaaatctgctaatgat
cgctatacattatttataaatggttccaaatgtgaagttcgcgcacgtaaactctcagac
ggtggattgttgatagcattaggtggtaaatcacatacaatttactggaaacaagaagtt
tccgctacaagattatctgtcgattcaatgactacccttttagaagtagaaaatgatcca
acacaattgcgtacaccatccccaggtaaattggtcaaattcttagttgaaaatggtgat
catattaaagcaggccaaccttatgctgaaattgaagttatgaaaatgcaaatgccatta
gtggcacaagaaagtggtgtagttcaattactaaaacaaccaggatctacaattgttgct
ggtgatatcatcgctatattaactttagatgatccatctaaggtgaaacatgctttacca
tttgaaggtttattacctgatttcggttccccagttgttgaaggtactaaacctgcttat
aaatttcaatctttagttacaactctggaaaacattttacaaggttacgataatcaagtc
atcatgaacgcatctttgcagcaattaatagaagtcttaagagatccaaaattaccatat
tctgaatggaagttacaaatttctgcgttacattccaggttaccagttgatttggatgag
aaattaagcgaattagtcgatcgatctgccaaacgtagtgctgttttcccggccaaacaa
attgcaaaaatgctagacaatgctgttaaacaaccagatactgacgctcaattactatcc
actttggaaccattacttgacattacaagaagatatacagatggtattgaagctcatgaa
cattccgtcttcgttaatttcttggaagagtactacgatgtcgaaaagttattcagctct
gcaaactcccgtgaagaatctgtgattttgaagttacgtgatgaaaacattgataactta
gataaggtcgccttaatagtcttatcccacgctaaagtttctgctaagaataacttgatt
ttggcaatattaaaacattaccaaccactatgcaagctttcatctcatgttgcacatatt
ttcacaactcctctacagcatctagtccagctagaatctaaatctacagcaaaggtcgca
ttacaagcaagagaaatattgattcaaggtgccttaccatctgtcaaggaaaggactgaa
caagttgaacatatattgaagtcatcagttgttggaactacttacggtgcatcgaattca
aagagaactgaaccagatctggagattttgaaagatttaatcgactccaattatgttgtc
tttgacgttttaatccaattcttaaatcatccagatccagctgtagctgctgctgctgca
caagtttacgttcgtagagcctatagagcttataccgttggtgaagttagaggtcatgca
tcaacttcgaatccagtcattgaatggaaatttcaattaccctctgctgcattctcatcc
attccacaaatgagaactaaaatgggtatgaatagagcaatttctgtttcagatttgaca
tatgttgtagatagtgaacattcacctttaagaacaggtattcttgttgctgctgatcat
ttggatgatgttgacacgaatttatctgaaagtttaggtgttatccctgaacatgcttcg
actactggcccagttccagacagatccggtagctcttcttcattgagtaatgtggctaat
atatttgttgcatctacagaaggttttgaaaatgaaactgccatcttaaaacgtattaga
gaaatattggatgttaataaacaagatttgatcaaatcagccattcgtcgtataactttc
atgtttggttgtactgatggttcatatccaaaatactataccttcaacggtccatcgtat
aacgagaatgaaacgattcgtcatattgaacctgcatgtgctttccaattagagttagga
agaatgtcgaatttcaatattaaaccaatcttcactgaaaacaggaacattcatgtgtat
gaagcagtcagtaagacttcgcctttagacaagagatttttcacaagaggtattattaga
actggccgtatcagcgctgacatatccatccaaaagtatctaacatctgaagctaataga
ttaatgagtgatattttagataatttggaaatcatcgatacctcaaactcagatttgaat
catattttcattaatttctctgcagtttttgatgtttctccagaagatgttgaagctgct
tttgccggtttcttagcaagattcggtaaacgttacttaagattacgcgtttcttctgct
gaaattcgcatcatcattcaagatccaaaaactggtactccagttccattacgtgcatta
attaataatgtctcaggttatgttgttaaatcagaattatatactgaagtgaagaataat
aagggtgaatgggtatttaaatctcttggtaagcctggttctatgcatttaagaccaatt
gccactccataccctgtgaaagaatggctacaaccaaaacgttataaggcacatttaatg
ggtactacatatgtttatgatttcccagatttattccatcaagcagcaatgtcacaatgg
gagaaatttggattagaaactccattatctgactcattctttattgctaatgaattaatt
gaagatgagaatggtgaattgactgaggttgaaagagaagcaggtgtaaattccattggt
atggttgcatttaaagttactgtgaagactccagaatatcctcgtggtcgtcaatttgtc
attgttgctaatgatattacttataagattggttcctttggtccacaagaagatgagttt
ttcaataaagttactgaatatgcaaggaagcgtggtattccaagaatctatttagctgcg
aactctggtgctagaattggtatcgcagaagaattagttccattgtatcaagttgcttgg
aaagatgataaagaccaatctaaaggattcgaatatttatatttgacaccagaaggcatg
gaaactttgaagagttacggtaaggagaaatctgtcttaactgagcgtgttgttgaaaat
ggtgaagaaagatttatcattaaaacgatcattggtgctgaagaaggtcttggtgttgaa
tgtttaagaggttctggtttgattgcaggtgctacatctagagcatatcaagatatcttt
accattactttagttacttgtagatctgttggtattggtgcttatttagttagattaggt
caaagagctattcaaattgaaggacaaccaattattttaactggtgctccagccatcaat
aaagttttaggtagagaagtttattcttctaatttacaattaggtggtactcaaatcatg
tataataacggtgtttcacatttaactgcatctgatgatttagctgctgtggaacaaatt
atggaatggttatcatatattccagctaaacgtaatatgcctgtaccaattttagaaact
gaagataaatgggatagacaaattgattttataccaagagttaatgaaccatatgatgtg
agatggatgattgaaggccgtactcttgaagatggtggatttgaatatggtcttttcgat
aagggatcatttttcgaaactttatcaggatgggctaaaggtgttgttgttggtagagct
cgtcttggtggtattccattgggtgttattggtgttgaaactaagactattgaaaatttg
atacctgctgatccagccaatccagattcaagagaaagtttaattcaagaagctggtcaa
gtttggtatccaaattcagcgtttaagacagcacaagctattaaagattttaatcatggt
gaacaattacctttgatgattttagccaattggagagggttttctggtggtcaacgtgat
atgtataatgaagttttgaaatatggttcatttatagttgatgcgttagttgattacaaa
caaccaatttccatttatattccacctactggtgaattaagaggtggttcatgggttgtt
gttgatccaacgattaattctgatcaaatggaaatgtatgctgacaaggattccagagct
ggtgtcttagaacctgaagggatggttggtattaaataccgtcgtgaaaagttactaggt
acaatggctagattagatgagaaatataagacattaagagagaaattaagtaacaaagat
ttaagtgttgaagaacatcaagatatttctaaacaattattaattcgtgaaagacaattg
atgccaatatataatcaaattagtatacaatttgctgatttacatgatcgttcacaacgt
atggttagtaagggagttattcgtcaagaattagaatgggttgaagctcgtcgtttcttt
ttctggagattaagaagaagattaaatgaagaatatttaattagaagacttgatgttgaa
ttaccagaagctgttcgtttagaaaagattgctagattaagatcttggtatccagctagt
gttgaccatgaaaatgatagacaagttgccacatggattgaagataattatcaattatta
gatgaacatttgaaatcgttaaaggtagaatcctttgcacaaggtttggctaagaaaatt
aggaatgatcatgataatgttattactggattatctgaagttttgaagatgttgtctagt
gaagataaggagaagattttaaaaagtatgaagtga

DBGET integrated database retrieval system