KEGG   Naumovozyma dairenensis: NDAI_0I01620Help
Entry
NDAI_0I01620      CDS       T02234                                 

Gene name
NDAI0I01620
Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ndi  Naumovozyma dairenensis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    NDAI_0I01620 (NDAI0I01620)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    NDAI_0I01620 (NDAI0I01620)
Enzymes [BR:ndi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     NDAI_0I01620 (NDAI0I01620)
Lipid biosynthesis proteins [BR:ndi01004]
 Desaturase
  First
   NDAI_0I01620 (NDAI0I01620)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9:complement(382761..384086)
Genome map
AA seq 441 aa AA seqDB search
MGSKEITQLNLPNTSYTPEQQQPHISELPWTINNWYLKINWLNMILVVFIPIIGFYLAIS
KHVPLQMNILYFSLAYYVIAGITITAGYHRLWSHRSYVAKWPLRLLFALFGAANVEGSIK
WWAHSHRIHHRYTDTPRDPYDARKGLWYSHMGWMLLKPNPKYRARADISDLNDDWIVRFQ
HRHYIPLMIFMSYILPTLICGKFFNGDYLGGFVYAGIIRVFAIQQATFCINSMAHYLGDQ
PFDDKRTPRDNWLTALVTFGEGYHNFHHEFPTDYRNAIKWYQYDPTKVFIYMTSCLGLAN
GLKKFSQNAIKQALVQQREKKLLKFKNNVHWGPTLDELPIWDKNDFMNEVNSNNNRKLVI
ISGIIHDVTNYTKEHPGGEKLLNSAVGKDGTRAFQGGVYRHSNSAHNVLADMRIAILKEK
KDSAINFVKRRGEKFDKQKLE
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgggatccaaagaaatcacacaattaaatctaccaaacacttcatacactccagagcag
caacaaccacacatctcagaattaccatggaccataaataattggtatttaaaaatcaat
tggttgaatatgatcttagtcgtattcatcccaatcattggattctatttagccatttca
aaacatgtccccttacaaatgaatatcttatatttttccttagcatattacgtcattgct
ggtataaccattacagcaggttatcatcgtctatggtcacatcgttcatacgttgccaaa
tggccattacgtttacttttcgccctatttggtgctgcaaatgtggaaggctctattaaa
tggtgggctcattctcatagaattcatcatcgttatacagatacaccaagagatccatat
gatgcaagaaaaggattatggtattctcatatggggtggatgcttttaaaaccaaatcca
aaatatagagcaagagctgatatttctgatttaaatgatgattggatcgttagatttcaa
catagacattatatcccattaatgatttttatgagttatatcttaccaactttaatttgt
gggaaattctttaatggtgattacttgggtgggtttgtttacgcggggattattagagtt
ttcgctattcaacaagctactttctgtattaattcaatggctcattatttaggtgatcaa
ccattcgatgataaaaggacgccaagagataattggttgacagctttggttacttttggt
gagggatatcataatttccatcatgaattcccaactgattatagaaatgctattaaatgg
tatcaatatgatccaacaaaagttttcatttatatgacttcatgtttaggattggctaat
ggattgaaaaaattctcacaaaatgcaattaaacaagctttagtacaacaaagagaaaag
aaacttttaaaatttaaaaataatgttcattggggaccaactttggatgaattaccaatt
tgggataagaatgattttatgaatgaagtaaatagtaataataacaggaaattggtaatt
atatcagggattattcatgatgttactaactatacaaaggaacatccaggtggtgaaaaa
cttttaaatagtgccgttggtaaagatggaacaagagcattccaaggtggggtttatcgt
cattcaaattcagctcataatgttttagctgatatgagaatcgctatcttaaaagagaag
aaagattctgcaattaatttcgttaaaagaagaggtgaaaaatttgataaacaaaaactt
gaatag

DBGET integrated database retrieval system