KEGG   Naumovozyma dairenensis: NDAI_0I01620Help
Entry
NDAI_0I01620      CDS       T02234                                 

Gene name
NDAI0I01620
Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ndi  Naumovozyma dairenensis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ndi01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:ndi01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9:complement(382761..384086)
Genome map
AA seq 441 aa AA seqDB search
MGSKEITQLNLPNTSYTPEQQQPHISELPWTINNWYLKINWLNMILVVFIPIIGFYLAIS
KHVPLQMNILYFSLAYYVIAGITITAGYHRLWSHRSYVAKWPLRLLFALFGAANVEGSIK
WWAHSHRIHHRYTDTPRDPYDARKGLWYSHMGWMLLKPNPKYRARADISDLNDDWIVRFQ
HRHYIPLMIFMSYILPTLICGKFFNGDYLGGFVYAGIIRVFAIQQATFCINSMAHYLGDQ
PFDDKRTPRDNWLTALVTFGEGYHNFHHEFPTDYRNAIKWYQYDPTKVFIYMTSCLGLAN
GLKKFSQNAIKQALVQQREKKLLKFKNNVHWGPTLDELPIWDKNDFMNEVNSNNNRKLVI
ISGIIHDVTNYTKEHPGGEKLLNSAVGKDGTRAFQGGVYRHSNSAHNVLADMRIAILKEK
KDSAINFVKRRGEKFDKQKLE
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgggatccaaagaaatcacacaattaaatctaccaaacacttcatacactccagagcag
caacaaccacacatctcagaattaccatggaccataaataattggtatttaaaaatcaat
tggttgaatatgatcttagtcgtattcatcccaatcattggattctatttagccatttca
aaacatgtccccttacaaatgaatatcttatatttttccttagcatattacgtcattgct
ggtataaccattacagcaggttatcatcgtctatggtcacatcgttcatacgttgccaaa
tggccattacgtttacttttcgccctatttggtgctgcaaatgtggaaggctctattaaa
tggtgggctcattctcatagaattcatcatcgttatacagatacaccaagagatccatat
gatgcaagaaaaggattatggtattctcatatggggtggatgcttttaaaaccaaatcca
aaatatagagcaagagctgatatttctgatttaaatgatgattggatcgttagatttcaa
catagacattatatcccattaatgatttttatgagttatatcttaccaactttaatttgt
gggaaattctttaatggtgattacttgggtgggtttgtttacgcggggattattagagtt
ttcgctattcaacaagctactttctgtattaattcaatggctcattatttaggtgatcaa
ccattcgatgataaaaggacgccaagagataattggttgacagctttggttacttttggt
gagggatatcataatttccatcatgaattcccaactgattatagaaatgctattaaatgg
tatcaatatgatccaacaaaagttttcatttatatgacttcatgtttaggattggctaat
ggattgaaaaaattctcacaaaatgcaattaaacaagctttagtacaacaaagagaaaag
aaacttttaaaatttaaaaataatgttcattggggaccaactttggatgaattaccaatt
tgggataagaatgattttatgaatgaagtaaatagtaataataacaggaaattggtaatt
atatcagggattattcatgatgttactaactatacaaaggaacatccaggtggtgaaaaa
cttttaaatagtgccgttggtaaagatggaacaagagcattccaaggtggggtttatcgt
cattcaaattcagctcataatgttttagctgatatgagaatcgctatcttaaaagagaag
aaagattctgcaattaatttcgttaaaagaagaggtgaaaaatttgataaacaaaaactt
gaatag

DBGET integrated database retrieval system