KEGG   Naumovozyma dairenensis: NDAI_0I02370Help
Entry
NDAI_0I02370      CDS       T02234                                 

Gene name
NDAI0I02370
Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
ndi  Naumovozyma dairenensis
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    NDAI_0I02370 (NDAI0I02370)
Enzymes [BR:ndi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     NDAI_0I02370 (NDAI0I02370)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9:540379..542661
Genome map
AA seq 760 aa AA seqDB search
MLDNSYIEKYNKSIGRKGKNKDKKTNEKNENEHSSIDSTDIIPSTLLNQLPTCVRSISHP
KQHLLSSAASLISSESHSIPETFSSTSDNALSLINTINNSISTTTSRQSNNKDKKNKNHS
KKNRRNGNNPISSAMLTEDGLLIKSNEQNTKKKNRSTTPYSLMKNHSNSNSIVTLDTSTT
SFRSSTESQFETASLISCVTCLSDTPGNNSSSLNSTISSNINENGNANDAHNHHRHHTSS
INGQLPNNVVIPYGRILNAKYVDEMDKENRYKIPKNGSRLVEITFAKPRRHDVIPKCLTL
LIEPLNSQSHTYLYSQTQAQTREEEEEEATSMEHDIIEEIFKRSYKNTKRKRSILVIINP
FGGKRKAKKLFMTKARPLLLASDCFLEVHYTKYVGHAIEIAKEMDIDKFDTIACASGDGI
PHEVINGLYRREDRVKAFNKLTITQIPCGSGNAMSVSCHWTNNPSYATLCLIKSVEVKVD
VMCCSQPSYVDEHPKLSFLSQTYGVIADSDINTESFRWMGSARFELGVAFNILQRKKYPC
DIYVKYAAKSKNELRSYYLEHKRKNHDYLNDSYNFRYELEEQQTGSIYANDDAIIDGMTD
IDDNYNDEHDDTVTEEDFKIKYPYKDGIPDDWERIDSKITDNLGIFYSGKMPYVAADTKF
FPAALPSDGAIDMVITDSRTPFTRMAPILLALDRGTHVLQPEVLHSKIKAYKIIPKVSNG
LFAIDGEKFPLEPLQVEIMPKLCKTLLRNGSFVDTEFDSM
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgctggataatagttatattgagaaatataataagagtattggaaggaaaggaaaaaat
aaggataagaaaaccaatgaaaaaaatgaaaatgaacattcatctatcgattctacagat
attattccatcaactttattgaatcaacttccaacatgtgtgagatcaatatctcatcct
aaacaacatttactatcatcagcagcttcacttatttcatccgaatcacactctattcca
gaaactttctcttctacttcagataatgctttgagtctcatcaatacgataaataactca
atatctacaacaacttcaagacaatctaataacaaagacaaaaagaataaaaaccattcc
aaaaagaacagaagaaatggtaataacccaatctcatcagccatgcttacagaagatggg
cttttaattaaatctaacgaacaaaataccaaaaaaaagaatagatctactactccatat
tcattaatgaagaatcatagtaattcaaacagcatagttacattagacacaagtacaaca
agcttccgtagtagtacagaaagccaatttgaaacggcctctttaattagttgtgttaca
tgtttaagtgatacaccaggtaataacagtagtagtttaaattcaacaataagtagtaat
attaatgaaaatggcaacgcaaatgacgcccataatcatcatcgacatcatacatcgtca
attaatgggcaattaccaaataatgttgtcataccatatggtagaatattgaacgcaaaa
tatgtcgatgaaatggataaagagaatcgctataagataccaaaaaatggttctagatta
gtggagataacctttgctaaaccaaggagacatgatgttataccgaaatgtctaacatta
ttaattgaaccattaaattcacaatcacatacatatctatattcacaaacgcaagcacaa
acacgagaggaagaagaagaagaagctacaagtatggaacatgacattattgaagaaata
tttaaaagaagttataaaaatacgaaaaggaaaagatcaattttagttataataaaccca
ttcggtggtaaaagaaaagccaaaaaattgtttatgacaaaggcaaggccattattatta
gctagtgattgtttccttgaagttcattatactaagtatgttggacatgcgattgaaata
gctaaggaaatggatattgataaatttgatactattgcatgcgcctcaggtgatggtata
cctcatgaagttataaatggattatatcgtcgagaagatcgtgttaaggcattcaataaa
ttgaccattactcaaattccatgtggatctggtaatgctatgagtgtttcttgtcattgg
acaaataatccatcatatgctacattatgtttgattaaatctgtagaggttaaagttgat
gttatgtgttgttctcaaccatcttatgtagatgagcatcccaaattatcatttttaagt
caaacttatggtgttattgctgattcagatataaatactgaatcatttagatggatgggg
tcggcaagatttgaattaggtgttgcatttaatattttacaaagaaaaaaatatccttgt
gatatttatgttaaatatgcagctaaatctaagaatgaattaagatcatattatttagag
cataaaaggaagaatcatgattatttgaatgattcatataattttcgatatgaactcgaa
gaacaacaaacgggttcaatatatgcaaacgatgatgccattattgacggtatgactgat
attgatgataattacaatgatgaacatgatgataccgttactgaggaagactttaaaatt
aaatatccttataaagatggtattcctgacgactgggaaaggattgattctaaaataacc
gacaatttaggaatattttactctggtaagatgccatatgttgcagctgatacgaaattt
ttccctgcagctttaccatctgatggagctatcgatatggttattacagattcaagaaca
ccattcactagaatggcgccaatattattagctttagatagaggaactcatgttttgcaa
ccggaagttttgcattctaagattaaagcatataaaattatacctaaagtttccaatgga
ttatttgccattgatggtgaaaaatttcccttggaacctttacaagtggaaattatgccc
aaattatgtaagacattattgagaaatggtagttttgttgacacagaattcgattccatg
taa

DBGET integrated database retrieval system