KEGG   Naumovozyma dairenensis: NDAI_0I02690Help
Entry
NDAI_0I02690      CDS       T02234                                 

Gene name
NDAI0I02690
Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ndi  Naumovozyma dairenensis
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:ndi00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:ndi04070]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9:632307..634949
Genome map
AA seq 880 aa AA seqDB search
MALDEPSNVPTTSITKRSSGDESATYSGLNLARTIKTVFRRSSDHITYINTTNISTNTND
AGPLTYSNSFWVDVNEYTGSKALMISNQLSHSCKLFQTDGIILKKITRRKQKAYRFKLGN
HLDIITWKNDTKILRLDSVKDIRIGEMATNYREEYGISDEFSNVWMTIIYNISKNKLKAL
HLMAENTKDFDLIFNCIFGLVKSRKELMESISVPDNEKFANIHWHTTVSERKEDESKDTL
SFEDVKKLCDRFHIYCSSNYLQIFSRIADVNQNDLLNFQEFQSFVKLLKKRREIENIWNA
ITNGSQKLSLEQFRHFVIETQNEYYTKAELRNIFKQYMKKESDSDGLFIDEEGFIKYLNA
QNAMHETKEDYTKPLNHYFIASSHNTYLLGKQYGETASVEGYIQVLQRGCRCVEIDIWDD
DSGPVVCHGFLTTAIPLRDVIDIIRKYAFIVSSYPLIISLEINCNKENQRKTSMIIKELL
GPMIYYGSQDPSLMLPSPKELKHKIIIKSKKTKHYSLAGSMTSPPSPMDSSTVSSFSSSY
ESEVDNNHNTMSTPSFSSSKHTISKEKAKRRNSNSSMTRVRRINLKNHIEVIHEMLEISA
IHGLKFRNFSLSESKATTHCFSLNEKKLDAMSMDKSLNLSIDKHNRKYLMRVYPNIFRYK
SSNFNPIKFWKSGCQMVALNWQTKDLGQQINLAMFQLTNQKDDVLHSGYILKPPTLLPVV
SKAKEIPILYENLKKERKLKDVTIQILSVQLLPNLKETKNTKKDETFGSYVIFEYIDDEE
PLSFDVTKNGTKISSCEASTIQCKENGFNPTWETELKLTLNCLDFTFIKFTVMANGVPLA
TSCLKLSYLKSGYRHIPLYSLEGEQYIFSTMFIYTKVIDQ
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atggcccttgatgaaccatcaaatgtgcctactacatcaattaccaaaagatcaagtggc
gatgaatcagctacatattctggtctcaatctagcaagaaccattaagacagtcttcaga
aggagttcagatcatattacttacatcaatactacaaatatttctactaatacaaacgat
gcaggcccattaacgtattcgaattcattttgggttgatgttaatgagtacactggttcg
aaggcattgatgatatcaaatcaattatcgcattcatgtaaattatttcaaactgatggg
attatattgaaaaagattactagaaggaaacaaaaggcttataggtttaaattagggaac
catttagatattattacatggaaaaatgatacaaaaatattacgattagattctgttaaa
gatattagaattggagaaatggcaacaaattatcgtgaagagtatgggataagtgatgaa
ttttcgaatgtttggatgacaataatatataatatttccaagaataagttgaaagcttta
catctaatggctgaaaatacaaaagatttcgatttgatatttaattgtatctttggttta
gtaaaatcaaggaaagaattgatggaaagtatttctgttcctgataatgaaaaattcgct
aatattcattggcatactactgtctctgaaaggaaagaggatgaaagtaaagatacatta
tcttttgaagatgtgaaaaagttgtgcgacagattccatatctactgttcctctaattac
cttcaaattttttctagaattgcagacgttaaccaaaatgatcttttgaatttccaagaa
ttccaaagttttgtaaaattattgaaaaaaagacgagagatagagaatatatggaatgcc
ataacaaatggctctcaaaaattgagtttggagcaattccgccatttcgtgatagagact
cagaatgaatattatacaaaggcagaactgcgaaatattttcaagcaatatatgaagaag
gaatctgattctgacggactgtttattgatgaagaaggttttattaaatatttaaatgca
caaaatgcaatgcatgaaaccaaggaagactacacgaaaccattgaatcattattttatt
gcatcttcccacaatacatatcttctagggaaacaatacggagaaacagcttccgtggaa
ggttacatacaggttttacaaagaggttgcagatgcgtagaaattgatatatgggatgat
gatagtggacctgttgtatgtcacggatttttaaccacagcaatccctttaagagatgtg
attgatatcatcaggaaatatgcatttattgtttcttcatatccactaataatatcatta
gaaatcaattgtaataaagaaaatcaaagaaagacgtcgatgataattaaagaactactc
ggacctatgatctattacggctctcaggatccatctctcatgttaccgtcacctaaggaa
ttaaaacataaaattataataaaatccaagaaaaccaaacattactccttggctggttca
atgacatcacctccttcaccaatggattcgagtacagtttcatcatttagttcctcttat
gaatccgaggttgataataatcataataccatgtccactccatcgtttagttcttcaaag
catacaatatctaaggagaaggcgaaaagacgaaattcaaatagttccatgacaagggtg
cggcgaataaatttaaagaatcatattgaagttattcatgaaatgttagagatctcagcg
atacatggacttaaatttaggaatttttcattatcagaatcaaaggcaacgactcattgt
ttttcattaaatgaaaaaaaattggatgcgatgtcaatggataaatcccttaatttatca
atagataaacacaataggaagtatctcatgcgggtgtatcctaatatattcaggtataaa
tcttctaattttaatcctattaaattttggaaatcaggatgtcaaatggtggccttaaat
tggcagacaaaagatttagggcaacagattaacttggcaatgtttcaattgacaaatcaa
aaggatgatgttttgcattccggttatattttgaaaccacctactctgttaccagtagtt
tcgaaagcaaaagaaattccaatactatatgaaaatctgaaaaaggaacggaaattaaaa
gatgtgacaattcaaatattatccgtccaattactaccaaacttgaaggaaactaagaac
accaagaaagatgaaacgtttggatcatatgtaatctttgagtatattgatgacgaggag
ccattaagttttgatgtcacaaagaatgggaccaagatttcaagctgtgaagcatccaca
atccagtgtaaggagaatggatttaaccctacgtgggagacagaattgaaattgactttg
aactgtctagattttacgtttatcaaatttactgtcatggcaaatggggttccattggct
acctcctgtttgaagttaagttatttgaaaagtggctatagacacattccgttatatagt
ctagaaggtgaacaatatatcttttccacgatgtttatatatacaaaagtgatagatcaa
tga

DBGET integrated database retrieval system