KEGG   Naumovozyma dairenensis: NDAI_0J00180Help
Entry
NDAI_0J00180      CDS       T02234                                 

Gene name
NDAI0J00180
Definition
hypothetical protein
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
ndi  Naumovozyma dairenensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NDAI_0J00180 (NDAI0J00180)
Enzymes [BR:ndi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     NDAI_0J00180 (NDAI0J00180)
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     NDAI_0J00180 (NDAI0J00180)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10:complement(24356..28927)
Genome map
AA seq 1523 aa AA seqDB search
MSLKRSVLLRLSDTGEPITSCSYGQGVLTLPSLPLPDDAKEGTPFYTVKLFISAGSPISR
NGLIWTNCPPEHTIPFQRDKFYKKVLNASFHQDDSVDLDIYRPGSYCFYLSFRNEKEQLE
TTRKFYFMVLPNLKINGQFLQLNSIAMQSVVSKWMGKDWDKIFAKIADKKYNMIHFTPLQ
IRGESNSPYSLCDHLKFDPDFFQSPDDVKKMVQHLQKDYGMLSLTDIVFNHTANNSPWLL
DHPEAGYNYITAPHLIPAIELDAKLLEFSQNLSNRGYPTDLKNIDDLFKIMDGIKVHVLG
SIKLWEYYVVDIESTLEGIKRVWNETSKWNENESSLQDLEDNLIKMGQFTRDNAVLENFG
TLAEKGSNKIDVEKFSSILKSLYGDELNDTIITKAHKILDQVNLPLYKEYDDDNSEILEQ
LFNRIKYLRIDENGPKQGPITDKQPLTEPYFTRFTGTDGNKYALANNGWIWNGNPLVDFA
SSKSKAYLRREVIVWGDCVKLRYGSGPQDSQYLWDRMGKYIEMNADIFDGFRIDNCHSTP
LHVGEYFLDLARRVNPNLYVVAELFSGSETMDCLFVERLGISSLIREAMQAWSEEELSRL
VHKHGGRPIGSYKFVPMDDFPYPADIQLDEEYCAVNPEDNALRCVSEIMIPKILTATPPH
ALFMDCTHDNQTPYQKRTVEDTLPNAALVALCSSAIGSVYGYDEIYPYLLELVTESRTYD
TESCDGIGKIRAMLNEIRDDIGMKSKDIEDSEMHVHHEGQYITFHRTDAKSGSGYYLIAR
TKFYDGGEQKLPPVILSDSICKLKLAYTLEKTGDVQESKTLIKGIPTNLRELKGFNVSYD
EKTRNSTILLPDDFPQGSIAIFETQQNGVDMWLDHFIRSGAIRATTNLNLESLNAILYRA
EPEEMDASAGRRGAYDIPNYGKLVYCGLQGWVSVLRKIMFNNDLAHPLSANLRGGHWALD
YVIDRLDLYNDEAGIEDVQRWLRSRLDRVKKLPNYLVPSYFCLIIGVLYGCCRLRAMQLM
SGNIGKSTEFVQSLAMTSIQMVSKMESTSLLPHENIPAMAAGLPHFSTEYMRCWGRDVFI
SLRGLLLTTGRFEQAKAHILAFAKTLKHGLIPNLLDAGRNPRYNARDAAWFFVQSVQDYV
SIVPGGESILKEKVTRRFPKDDTYIKYNDPIAFSYSSTIEEIVYEILSRHAAGIKYREAN
AGPNLDRVMTDKGFDVEVHVDWSNGLIFGGSQYNCGTWMDKMGESAKAKSVGIPGTPRDG
AAIEINGLLKSCLRFVIDMNKKNNFQYSEVTKSDGTKISFVEWDKLLQDNFEKCYWIPKD
AADDKLFDVDVNIVNRRGIYKDLYRSGKPYEDYQLRPNFAIAMTVAPELFTPGFAISAIE
LADKYLRGPVGMRTLDPSDYNYRPYYINSEDSEDFATSKGRNYHQGPEWVWCYGYFLRAF
HYFYFNTSRRCQNEPKSKPSSYLYQQLYNRLQGHRDWLAQSPWAGLTELTNKDGEICNDS
SPTQAWSSGCLLDVFYDLWSAYE
NT seq 4572 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgaaaagaagtgtattacttagattatcggatacaggtgaaccaattacgagt
tgttcctatggtcaaggtgtattaacattaccatctttgccactcccagatgatgctaaa
gagggaacaccattctatacagtaaaattgttcatctctgctggttcccccatctcaaga
aatgggttaatttggacaaattgtcccccagaacataccatccctttccaaagggataaa
ttctataaaaaagtcttaaacgcaagcttccatcaagatgatagtgtagatctagatatc
tatagaccaggttcatattgtttctatctatccttcagaaatgaaaaagaacaattagaa
actacaaggaaattttatttcatggtattgcccaatttaaagataaatggtcaattcttg
caattaaattcaatcgctatgcaaagtgtcgtatccaaatggatgggtaaagattgggat
aaaatctttgccaagatagctgataagaaatataatatgattcatttcactcctttacaa
atcagaggtgaatcaaattctccatattctttatgtgatcatttgaaatttgatcctgat
tttttccaatctcctgatgacgtcaagaaaatggtgcagcatctacaaaaggattatgga
atgttatcactgactgatatcgtctttaaccatactgctaacaattctccttggctattg
gatcatccagaagctgggtataattatatcaccgctccccatttgatcccagctattgaa
ctagatgccaaattgttggaatttagccaaaacctatccaatagaggttatccaacagat
ctgaagaatatcgacgacttgttcaaaattatggatggtattaaagttcatgttcttggt
tccataaaattatgggaatattatgtcgttgatattgaatccacactcgaaggtatcaaa
agggtttggaatgaaacttccaaatggaatgaaaatgaatcttcactacaagatttagaa
gataacttgattaaaatgggccaatttactcgcgataacgctgttcttgaaaatttcgga
accttggccgaaaaaggttcaaataaaattgatgtggaaaaattctcaagtatattaaaa
tccttatatggtgatgaattaaatgatacaattattacaaaggcccataagatattagat
caagttaacttaccattatacaaagaatatgatgatgataatagtgaaatcctagaacaa
ttgttcaaccgtatcaaatatttgagaattgatgagaatggtccaaaacaaggtcctatt
actgataaacaaccattgacagaaccttatttcactcgttttacaggtacagatggtaat
aaatatgcattagcaaataatggctggatatggaatggtaacccattagtcgattttgcc
tcttccaaatcaaaagcttacttgcgcagagaagtaattgtttggggtgattgtgttaaa
ttaagatatggttcaggtccacaagattctcagtatttatgggatagaatgggtaaatac
atagaaatgaatgcagatatcttcgatgggttcagaattgataattgtcattctactccc
ttacacgttggtgaatattttttagatcttgcaagaagagtcaatccaaacttatatgtc
gttgccgaattattttcgggttcagaaacaatggattgtttattcgttgagagattaggt
atttcatctttaataagagaagctatgcaagcatggtctgaggaagaactttcaagatta
gtccataaacatggtggtagaccaattggttcatacaaattcgttcctatggatgatttc
ccatatccagccgatattcagttagatgaagaatattgcgctgttaatccagaagataac
gctttaagatgtgtttctgaaatcatgatccccaaaattttaaccgctactcctccacat
gccttattcatggactgcacacatgataatcaaacaccctatcagaaaaggacagttgaa
gacactttacctaatgctgcattagtagctttatgttcctctgctattggttccgtttat
ggttacgatgaaatttatccatatttattagaattagttactgaatcgagaacctatgat
acagaatcttgtgatggtattggcaaaattagagccatgctaaatgaaataagagatgat
attggtatgaaaagtaaagatattgaagattctgaaatgcatgtccatcatgagggtcaa
tatatcacatttcatagaacagatgccaagagtggttcaggttattatttaattgcaaga
actaaattttatgatgggggtgaacaaaagttaccacctgtaatattgagtgattccatt
tgtaaattaaaattagcttatactttggaaaaaactggtgatgtacaagaatcgaagaca
ttaattaaaggtattccaactaatctgagggaattgaaaggttttaacgtgtcttacgat
gaaaagacaagaaattctacaattttattacctgacgatttcccacagggttcgatcgca
atttttgaaactcaacaaaatggtgttgatatgtggttagatcatttcattagatctggt
gctattagagctacaaccaatttgaacttagaatcgttgaatgcaatcttgtatcgcgcg
gaacctgaagaaatggatgctagtgctggtagaagaggtgcttatgatattcctaattat
ggtaagttagtgtactgtggtttgcaaggttgggtatccgtgctaagaaaaatcatgttt
aataacgatttagctcatccattaagtgccaatttacgtgggggccattgggctttagac
tatgtcattgatagattagacctttataatgatgaagcaggtattgaagatgtccaaaga
tggttacgtagtagattagatagagtaaagaaattaccaaattatttggttccaagttat
ttctgcttaattattggtgtcttatatggttgttgtcgtttacgtgctatgcaattaatg
tctggaaatattggtaaatccactgaatttgttcaaagtttggcgatgacttccattcaa
atggtttccaagatggaatctacatctttattgccacacgaaaatattcctgctatggca
gctggtcttccccatttcagtactgaatatatgagatgttggggtagagatgttttcata
tccttaagagggttgttattaactactggaagatttgagcaagctaaagctcatattctt
gcatttgctaaaacattaaagcatggtttaattccaaatttattggatgctggcaggaat
ccaaggtataatgccagagatgctgcttggttctttgttcaatctgttcaagattatgtt
agtatcgttcctggaggtgaatcgatcttaaaggaaaaggttactaggagattccccaag
gatgatacctatattaaatataacgatcctattgccttcagttattcgagtaccattgaa
gaaattgtctatgagattttaagtaggcatgcagctggcatcaaatatagagaagctaat
gctggtccaaatttagatagagttatgacagataaaggttttgatgtcgaggttcatgtt
gattggtctaatggtttaatcttcggtgggtcacaatataactgtggtacatggatggat
aagatgggtgaaagtgctaaggcaaaatcagttggtataccaggaacaccaagggacggt
gcggcaatagaaattaacggattattaaagagttgtttaagatttgtcattgatatgaac
aagaaaaacaatttccaatattccgaagttactaaatcagatggtactaagatttccttt
gttgaatgggataagttgttacaagataactttgaaaaatgttactggattccaaaagat
gcagctgatgataaattatttgatgtggatgttaacattgtgaacaggagaggtatttac
aaagatttgtatcgatctggtaagccatatgaagactatcaattaagacctaattttgcc
attgcgatgactgttgctccagaattatttacacctggttttgccatttcagctatagag
ttggcagataaatatttaagaggaccagttggtatgcgtacattagatccaagtgattat
aattatcgtccatattatattaattcagaagattcagaagattttgctacatctaagggt
agaaactatcatcaaggacctgaatgggtatggtgctacggttatttcttaagagctttc
cattacttctatttcaatacatcaagacgttgtcaaaacgagccaaagagtaaaccatca
tcctacttataccaacaattgtacaatagattgcaaggtcatagagattggttagcacaa
agtccatgggcagggttaacagagttgactaacaaagacggtgaaatttgtaatgattcc
agtccaacacaagcatggagttctggatgtttattggatgtcttttatgatctatggagt
gcctatgaatag

DBGET integrated database retrieval system