KEGG   Naumovozyma dairenensis: NDAI_0J00970Help
Entry
NDAI_0J00970      CDS       T02234                                 

Gene name
NDAI0J00970
Definition
(RefSeq) hypothetical protein
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ndi  Naumovozyma dairenensis
Pathway
ndi00020  Citrate cycle (TCA cycle)
ndi00310  Lysine degradation
ndi01100  Metabolic pathways
ndi01110  Biosynthesis of secondary metabolites
ndi01130  Biosynthesis of antibiotics
ndi01200  Carbon metabolism
Module
ndi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ndi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NDAI_0J00970 (NDAI0J00970)
  Amino acid metabolism
   00310 Lysine degradation
    NDAI_0J00970 (NDAI0J00970)
Enzymes [BR:ndi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NDAI_0J00970 (NDAI0J00970)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 GCV_H HlyD_3 DUF1631 RnfC_N PYNP_C HlyD_D23 CPSF100_C
Motif
Other DBs
NCBI-GeneID: 11494169
NCBI-ProteinID: XP_003672232
UniProt: G0WGR1
Position
10:223135..224505
Genome map
AA seq 456 aa AA seqDB search
MLSRSNTLTSTSRRIIPRILKGPNAVRTVSTTSTAIKRQYHLIKTNYTSSPLTLNNTVLS
SSLTFYNHAHRFASTKVEVPPMAESLTEGSLKEFTKKVGDYIKQDDLLATIETDKIDIEV
IAPVTGKITKLNFNPDDTVVVGDELATIEEGEFQESSSDAPAETKEETTKKEPSETKKEE
PSLKKDEKKEPAPAPSKREPTPAPATSAKDTSASSSTTPSWTSFSRNENRVKMNRMRLRI
AERLKESQNTAASLTTFNEVDMTSLLEMRKLYKDEIIKKNGIKFGFMGLFSKACCLASKD
IPGVNGAIEGDQIVYRDFVDISMAVATPKGLVTPVIRNVESLSVLEIENELVKVSKKARD
GKLTLEDMTGGTFTISNGGVFGSLFGTPIINMPQTAVLGLHGVKERPVSINGQIVSRPMM
YMALTYDHRLLDGREAVTFLKTVKELIEDPRKMMLF
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgctatccagatcaaacacattaacgagtacctcccgtcggatcattcctagaatcctc
aaaggtcccaacgcagttagaacagtctccactacatcaacagcaataaagagacaatat
cacctaataaaaacaaattatacttcctccccattaacgctcaacaacacggtcctttcc
tcgtccttaactttctacaatcatgcacaccgtttcgcatccacgaaagtggaagttcct
ccaatggcagaatcattaactgaaggttcattgaaggaattcaccaaaaaagtaggagat
tacatcaaacaagatgatttattagctaccatcgaaacagataagattgatattgaagtc
atcgctcctgtcacgggaaaaatcacaaaattgaattttaaccctgatgatacagtcgtt
gtaggtgacgaattggcaaccattgaagaaggtgagttccaggaatcttcttctgatgct
cctgctgaaactaaggaagaaacaacaaaaaaggaaccatctgaaaccaaaaaggaagaa
ccttctttaaagaaggatgaaaagaaagaacctgctccagcaccaagtaaacgagaacct
acccctgctcctgctacctctgcgaaagacacaagtgcaagttcaagtactacaccatct
tggacctcattctcacgtaatgaaaatagagtgaaaatgaacagaatgagattaagaatc
gcagaaagattaaaggaatcacaaaacactgctgcatcattaaccacattcaatgaagtc
gacatgacttcactcttagaaatgaggaaattatataaagatgaaatcattaagaaaaat
ggtatcaaatttggtttcatgggattattctctaaagcttgttgtttagcctccaaagat
atcccaggtgttaatggtgccattgaaggtgatcaaattgtatatagagattttgtcgat
atctccatggctgttgctactcctaaggggttggttacaccagtgattcgtaatgtggaa
tctttatctgtcttagaaattgaaaatgaattagttaaagttagtaaaaaggctcgtgat
gggaaattaactttggaagatatgacaggtggtacttttaccatctctaatggtggtgtg
tttggttcattatttggtactcctattattaatatgccacaaactgcggtcttaggattg
catggtgttaaggaaagacctgtaagtatcaatggacaaatcgtttcaagaccaatgatg
tatatggctttaacttatgatcatagattattggatggtagagaagctgttacattcttg
aaaactgtaaaggaattaattgaagatccaaggaaaatgatgctattttaa

DBGET integrated database retrieval system