KEGG   Naumovozyma dairenensis: NDAI_0J00970Help
Entry
NDAI_0J00970      CDS       T02234                                 

Gene name
NDAI0J00970
Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ndi  Naumovozyma dairenensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:ndi01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ndi00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:ndi00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10:223135..224505
Genome map
AA seq 456 aa AA seqDB search
MLSRSNTLTSTSRRIIPRILKGPNAVRTVSTTSTAIKRQYHLIKTNYTSSPLTLNNTVLS
SSLTFYNHAHRFASTKVEVPPMAESLTEGSLKEFTKKVGDYIKQDDLLATIETDKIDIEV
IAPVTGKITKLNFNPDDTVVVGDELATIEEGEFQESSSDAPAETKEETTKKEPSETKKEE
PSLKKDEKKEPAPAPSKREPTPAPATSAKDTSASSSTTPSWTSFSRNENRVKMNRMRLRI
AERLKESQNTAASLTTFNEVDMTSLLEMRKLYKDEIIKKNGIKFGFMGLFSKACCLASKD
IPGVNGAIEGDQIVYRDFVDISMAVATPKGLVTPVIRNVESLSVLEIENELVKVSKKARD
GKLTLEDMTGGTFTISNGGVFGSLFGTPIINMPQTAVLGLHGVKERPVSINGQIVSRPMM
YMALTYDHRLLDGREAVTFLKTVKELIEDPRKMMLF
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgctatccagatcaaacacattaacgagtacctcccgtcggatcattcctagaatcctc
aaaggtcccaacgcagttagaacagtctccactacatcaacagcaataaagagacaatat
cacctaataaaaacaaattatacttcctccccattaacgctcaacaacacggtcctttcc
tcgtccttaactttctacaatcatgcacaccgtttcgcatccacgaaagtggaagttcct
ccaatggcagaatcattaactgaaggttcattgaaggaattcaccaaaaaagtaggagat
tacatcaaacaagatgatttattagctaccatcgaaacagataagattgatattgaagtc
atcgctcctgtcacgggaaaaatcacaaaattgaattttaaccctgatgatacagtcgtt
gtaggtgacgaattggcaaccattgaagaaggtgagttccaggaatcttcttctgatgct
cctgctgaaactaaggaagaaacaacaaaaaaggaaccatctgaaaccaaaaaggaagaa
ccttctttaaagaaggatgaaaagaaagaacctgctccagcaccaagtaaacgagaacct
acccctgctcctgctacctctgcgaaagacacaagtgcaagttcaagtactacaccatct
tggacctcattctcacgtaatgaaaatagagtgaaaatgaacagaatgagattaagaatc
gcagaaagattaaaggaatcacaaaacactgctgcatcattaaccacattcaatgaagtc
gacatgacttcactcttagaaatgaggaaattatataaagatgaaatcattaagaaaaat
ggtatcaaatttggtttcatgggattattctctaaagcttgttgtttagcctccaaagat
atcccaggtgttaatggtgccattgaaggtgatcaaattgtatatagagattttgtcgat
atctccatggctgttgctactcctaaggggttggttacaccagtgattcgtaatgtggaa
tctttatctgtcttagaaattgaaaatgaattagttaaagttagtaaaaaggctcgtgat
gggaaattaactttggaagatatgacaggtggtacttttaccatctctaatggtggtgtg
tttggttcattatttggtactcctattattaatatgccacaaactgcggtcttaggattg
catggtgttaaggaaagacctgtaagtatcaatggacaaatcgtttcaagaccaatgatg
tatatggctttaacttatgatcatagattattggatggtagagaagctgttacattcttg
aaaactgtaaaggaattaattgaagatccaaggaaaatgatgctattttaa

DBGET integrated database retrieval system